KEGG   Brevundimonas diminuta: EQG53_03705Help
Entry
EQG53_03705       CDS       T05851                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bdm  Brevundimonas diminuta
Pathway
bdm00020  Citrate cycle (TCA cycle)
bdm00190  Oxidative phosphorylation
bdm00650  Butanoate metabolism
bdm01100  Metabolic pathways
bdm01110  Biosynthesis of secondary metabolites
bdm01120  Microbial metabolism in diverse environments
bdm01130  Biosynthesis of antibiotics
bdm01200  Carbon metabolism
Module
bdm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bdm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bdm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EQG53_03705
   00650 Butanoate metabolism
    EQG53_03705
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EQG53_03705
Enzymes [BR:bdm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EQG53_03705
    1.3.5.4  fumarate reductase (quinol)
     EQG53_03705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-ProteinID: QAT13533
UniProt: A0A246KKY5
LinkDB All DBs
Position
729972..730769
Genome map
AA seq 265 aa AA seqDB search
MVQLNLPRGSKPTTGKVHKAPAGAKNVKTYKVYRYDPETDADPRWDSYEVSTDDHGPMLL
DALIHIKNEIDPTLSFRRSCREGICGSCSMNIDGRNTLACTKGWDECSSHNITIAPLPHQ
PVVKDLVTDLSLFYAQYDSIQPYLQSDLPDPEKERLQSPADREKLDGLYECILCACCSTS
CPSYWWNQEEYLGPAALLQSYRWISDSRDDATQKRLDDLEDPFKLYRCHTIMNCAQVCPK
GLNPAKAIAETKKLMVSPSRKKTAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggttcagctcaacctcccgcgcggctccaagcccacgaccggcaaggtccacaaggct
ccggccggtgccaagaacgtcaagacctacaaggtctatcgctacgacccggagacggac
gccgatccgcgctgggattcgtacgaggtctcgaccgacgatcacggccccatgcttctg
gacgccctgatccacatcaagaacgagatcgacccgaccctgtcgttccgtcgctcgtgc
cgtgaaggcatctgcggctcgtgctcgatgaacatcgacggccgcaacaccctggcctgc
accaagggctgggacgagtgctcgtcgcacaacatcaccatcgcccccctgccccaccag
ccggtggtcaaggatctggtgacggacctgtcgctgttctacgcccagtacgactcgatc
cagccctacctccagtccgacctgccggacccggaaaaggagcgcctgcagtcgcccgcc
gaccgcgagaagctggacggcctgtacgagtgcatcctgtgcgcctgctgctcgacctcg
tgcccgagctactggtggaaccaggaagaatacctcggcccggcggccctgctgcagtcc
taccgctggatctcggacagccgcgacgacgccacccagaagcgtctcgacgacctggaa
gacccgttcaagctgtatcgctgccacacgatcatgaactgcgcccaggtctgccccaag
gggctgaacccggccaaggcgatcgccgagaccaagaagctgatggtttcgccgtcccgc
aagaagacggccgcctga

DBGET integrated database retrieval system