KEGG   Brevundimonas diminuta: EQG53_10460Help
Entry
EQG53_10460       CDS       T05851                                 

Definition
(GenBank) aminodeoxychorismate/anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
bdm  Brevundimonas diminuta
Pathway
bdm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bdm01100  Metabolic pathways
bdm01110  Biosynthesis of secondary metabolites
bdm01130  Biosynthesis of antibiotics
bdm01230  Biosynthesis of amino acids
bdm02024  Quorum sensing
Module
bdm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bdm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EQG53_10460
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    EQG53_10460
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EQG53_10460
Enzymes [BR:bdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     EQG53_10460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 FleQ
Motif
Other DBs
NCBI-ProteinID: QAT14749
UniProt: A0A410NY16
LinkDB All DBs
Position
complement(2102371..2102961)
Genome map
AA seq 196 aa AA seqDB search
MILVVDNYDSFTYNLVHYLAELGAQTHVIRNDDLTVEEAWALKPEAVLLSPGPCAPDQAG
ICLSLIETAAETMPILGVCLGHQSIGQAFGGEVVRAKTLMHGKTSPIQHEGRGVFGGLPS
PFTATRYHSLAVRRETLPDALEVTAWTEDGEIMGLSHRSRPIHGVQFHPESIATQHGHAM
IANFLDLAGVKRSANV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgtcgtcgataactacgacagcttcacctacaacctcgtccactacctcgcg
gagttgggcgcccagacgcacgtcatccgcaacgacgacctgaccgtcgaagaagcctgg
gcgctgaagcccgaggccgtcctgctgtcgcccggcccctgcgcccccgatcaggcgggc
atctgcctgtcgctgatcgaaacggccgcagagaccatgcccatcctcggcgtctgcctg
ggccaccagtcgatcggccaggccttcggcggcgaggtggtgcgcgccaagaccctgatg
cacggcaagacctcgcccatccaacatgaagggcgcggcgtcttcggcggcctgccctcg
cccttcacggcgacgcgctatcattcgctggccgtgcgccgcgagaccctgcccgacgcg
ctggaggtcaccgcctggacagaggacggcgagatcatgggcctgtcgcaccgctcgcgg
ccgattcacggcgtccagttccacccggaatccatcgccacccagcacggccatgcgatg
atcgccaacttcctcgatctggcgggcgtcaaacgatcggcgaacgtctga

DBGET integrated database retrieval system