KEGG   Brevundimonas diminuta: EQG53_15975Help
Entry
EQG53_15975       CDS       T05851                                 

Definition
(GenBank) ATP-binding cassette domain-containing protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bdm  Brevundimonas diminuta
Brite
KEGG Orthology (KO) [BR:bdm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bdm02000]
    EQG53_15975
Transporters [BR:bdm02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    EQG53_15975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_27 SbcCD_C AAA_23
Motif
Other DBs
NCBI-ProteinID: QAT15719
UniProt: A0A410P0X8
LinkDB All DBs
Position
complement(3259024..3259986)
Genome map
AA seq 320 aa AA seqDB search
MVAALTLDGISKRYGGFQAVSDLSFQVEKGSICGFLGPNGAGKTSTLRMILGLQPATSGR
IDILGADDGRKVRDRIGFLPEERGLYKKMTPVDAIAFFGGLKGLPLPEGRRRGREMLEQM
GLGEASKKKMKELSKGMAQKVQLIASVVHQPEFVILDEPFSGLDPMNQQGLEAMIRALAD
NGATVLFSTHVMQHAERLCDKVVLLARGRKAFEGTVDEARATSPRFLELEGTLDRNAVAV
LPGVGGIEVLAEDGLVSTLRVGLTPGAEAQSALRAAFLGGLDVRRFQMKEPTLHDAFIAL
TGDHPDEDPSVSKTDKAGAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcggcgctgacgctggatggaatcagtaagagatacggaggcttccaggcggtc
tccgacctgagcttccaggtcgagaagggctcgatctgcggcttcctggggccgaacggg
gcgggcaagacctcgaccttgcggatgatcctggggctgcagccggccaccagcggccgc
atcgacatcttgggcgcggacgacggccgcaaggtgcgcgatcggatcggcttcctgccc
gaggagcggggcctctataaaaagatgacgccggtggacgccatcgccttcttcggcggg
ctgaagggcctgcccctgcccgaaggccgccgtcgcggccgcgagatgctggagcagatg
ggtctgggcgaggccagcaagaagaagatgaaggagctgtccaaggggatggcccagaag
gttcagctgatcgcctcggtggtgcatcagccggagttcgtgatcctggacgagccgttc
tcgggtctcgatccgatgaaccagcaggggctggaggccatgatccgcgccctggccgac
aatggggcgacggttctgttctcgacccacgtcatgcagcacgccgagcgtctgtgcgac
aaggtggtgctgctggcccgcggccgtaaggcgttcgagggcacggtggatgaggcgcgg
gcgacctcgccgcgctttctggagctggaagggacgctggatcgcaatgcggtcgccgtc
ctgccgggcgtcggcggcatcgaggtgctggccgaggacggcctcgtcagcaccctgcgc
gtcggcctgacgccgggagcggaggcgcaaagcgccctgcgcgccgccttcctgggcggg
ctggacgtaaggcgcttccagatgaaggagccgaccctgcacgacgccttcatcgccctg
accggcgaccacccggacgaagatccgtccgtctccaagaccgataaagcgggagccgcc
tga

DBGET integrated database retrieval system