KEGG   Bifidobacterium dentium JCM 1195 = DSM 20436: BBDE_0270Help
Entry
BBDE_0270         CDS       T04222                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bdn  Bifidobacterium dentium JCM 1195 = DSM 20436
Pathway
bdn00473  D-Alanine metabolism
bdn00550  Peptidoglycan biosynthesis
bdn01100  Metabolic pathways
bdn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bdn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BBDE_0270
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBDE_0270
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BBDE_0270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bdn01011]
    BBDE_0270
Enzymes [BR:bdn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BBDE_0270
Peptidoglycan biosynthesis and degradation proteins [BR:bdn01011]
 Precursor biosynthesis
  Amino acid ligase
   BBDE_0270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BAQ26264
LinkDB All DBs
Position
359503..360639
Genome map
AA seq 378 aa AA seqDB search
MAKKRIVVMYGGKADEHSISCISTAGVLRALDVEKFEAIPVGITKTGQWIVDGEDPRGWN
MSEGMPIVRKTDTAKDVVLDVALGQDGFFAREADGTLTSLGHVDAVLPVLHGPYGEDGTI
QGLFEMMNVPYVGCGVFASAACMDKHYTKVLLAAAGIPVAPGITLDARDCDAACAFAANG
ETMLAAVQAAGLRYPLFVKPSRAGSSFGVTKVEREGDAAELAAAVFEASHHDWRVLVEQG
IDAREIECAVLCPKAGDEPRASWPGEIVLDKRAGGDDQFYDFDSKYMDAEASHVEVPAAL
PQETLELVRETAKKAFKAVDGTGLSRVDTFVTADGKVMVNEINTMPGFTPISMYPKAWDA
TGVSYTDLISTLIEGVLE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagcgcattgtggtgatgtatggcggcaaggccgatgagcattcgatttcg
tgcatctccaccgcaggagtgctgcgtgcgctggatgtggagaagttcgaggcgattccg
gtcggcatcaccaaaaccggccagtggatcgtcgacggtgaggatccgcgcggctggaac
atgagcgaaggcatgccaatcgtcaggaaaaccgataccgccaaggacgtggtgcttgac
gtggctctcggccaagacggtttcttcgcgcgtgaggccgacggtacgctgacctccctt
ggccatgtggacgcggtgttgccggtgctgcacggtccgtatggcgaggacggcaccatc
caaggtctgttcgaaatgatgaacgtgccgtacgtgggttgcggtgtgttcgcctccgcc
gcttgcatggacaagcactatacgaaggtgctgctggctgccgccggcattccggtcgcc
cccggcattacgttggatgcacgcgattgcgatgcagcttgcgcatttgccgcaaacggc
gaaacgatgttggccgcggtacaggctgcgggattgcggtatccgctgttcgtcaagccg
tcccgtgccggttccagcttcggcgtgaccaaggtggaacgcgagggtgacgccgccgaa
ctggccgccgccgtattcgaagcatcccaccatgattggcgtgtgctggtcgagcaaggc
atcgacgctcgtgagatcgaatgtgcggtgctgtgcccgaaagccggcgacgaaccgcgt
gccagctggccgggtgagattgtgcttgacaagcgtgccggcggcgacgatcagttctac
gatttcgacagcaaatacatggacgccgaggcgagccatgtggaagtgcctgcggccctg
cctcaggagacgctcgaactggtgcgtgaaaccgcgaagaaggcgttcaaagcggtcgat
ggcacaggcctaagccgtgtggacacgttcgtgacggccgatggcaaggtgatggtcaac
gaaatcaacaccatgccgggcttcacgccgatttccatgtatcccaaggcgtgggacgcc
acaggcgtaagctataccgatctgatctccaccctcatcgaaggcgtgctggagtag

DBGET integrated database retrieval system