KEGG   Bifidobacterium dentium JCM 1195 = DSM 20436: BBDE_0385Help
Entry
BBDE_0385         CDS       T04222                                 

Definition
(GenBank) putative acetyltransferase
  KO
K03790  [ribosomal protein S5]-alanine N-acetyltransferase [EC:2.3.1.267]
Organism
bdn  Bifidobacterium dentium JCM 1195 = DSM 20436
Brite
KEGG Orthology (KO) [BR:bdn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bdn03009]
    BBDE_0385
Enzymes [BR:bdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.267  [ribosomal protein S5]-alanine N-acetyltransferase
     BBDE_0385
Ribosome biogenesis [BR:bdn03009]
 Prokaryotic type
  ribosomal protein modification factors
   BBDE_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_4 Acetyltransf_1
Motif
Other DBs
NCBI-ProteinID: BAQ26379
LinkDB All DBs
Position
498171..498824
Genome map
AA seq 217 aa AA seqDB search
MTVFQAFRDMICPIRANAIAVPQFIQSQALQVPIRLRPLTADDDDEWNEVRWRNDAWLRP
WESGDPLHGQSMSFDMWIRRLRSNERDGTGVVFVMEHQRRIVGQISLGAICYGAMRTGVV
GYWVDERCAGRGFAPMAVTLLADWAMFDPDGPHLHRLEIALLPENARSRRVAVKVGAHFE
GVRRAYMYVNGRWRDHETYAMTSEDAPNGFTARLMTA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttttccaagcattccgcgacatgatatgtcccatacgggccaatgccatcgcc
gtgccgcagttcatacagtcgcaggcactgcaggtaccgatccggctgcgtccgcttact
gcggatgatgacgacgaatggaatgaggtgcgctggcgcaacgatgcctggttgcgtccg
tgggagtcgggcgatccgttgcacggccagtcgatgtcgttcgatatgtggatacggcgg
ttgcgcagtaacgagcgtgacggcaccggggtggtgttcgtcatggaacatcagcggcgc
atcgtcggccagatttcgctcggagcgatttgctacggcgcgatgcgtaccggcgtagtc
gggtattgggtggatgaacgttgcgctgggcgtggattcgcgccgatggcagtgacgttg
ttggcggattgggccatgttcgaccccgacgggccgcacctgcatcggctggaaattgca
ctgctgcccgaaaacgcccgttccagacgtgtcgccgtcaaggtaggggcgcatttcgag
ggggtgcgccgcgcctacatgtatgtcaatgggcggtggcgcgatcatgagacctacgcc
atgacatccgaggacgcccccaacggtttcacggccaggctgatgactgcgtag

DBGET integrated database retrieval system