KEGG   Bifidobacterium dentium JCM 1195 = DSM 20436: BBDE_1657Help
Entry
BBDE_1657         CDS       T04222                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bdn  Bifidobacterium dentium JCM 1195 = DSM 20436
Pathway
bdn00250  Alanine, aspartate and glutamate metabolism
bdn00410  beta-Alanine metabolism
bdn00430  Taurine and hypotaurine metabolism
bdn00650  Butanoate metabolism
bdn01100  Metabolic pathways
bdn01110  Biosynthesis of secondary metabolites
bdn01120  Microbial metabolism in diverse environments
bdn02024  Quorum sensing
Module
bdn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BBDE_1657
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBDE_1657
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBDE_1657
   00430 Taurine and hypotaurine metabolism
    BBDE_1657
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBDE_1657
Enzymes [BR:bdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BBDE_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DotU
Motif
Other DBs
NCBI-ProteinID: BAQ27651
LinkDB All DBs
Position
1980239..1981669
Genome map
AA seq 476 aa AA seqDB search
MSIMHSNINTIAAGYGYSGGADSDSVEVNPLFARPKEAKAFSKFKIPQEGSLPETAYQVV
HDDAMLDGNARLNLATFVSTWMDDYANRLYMEAADKNMIDKDEYPKTAEVESRCWHMLAD
LWHAPDPMNTIGTSTIGSSEACMLGGLALKRRWKEAREKAGLPADRPNLVMSSAVQVCWE
KFCNYFDVEPRYVPISEEHKVLDGYDLDKYVDENTIGVVAIMGVTYTGMYEPVKKISDAL
DRIEERTGLDVRIHVDAASGGMIAPFIQPDLQWDFRVKRVYSISTSGHKYGLVYPGLGWV
VWRETADLPESLIFKVSYLGGEMPTFALNFSRPGAQVLLQYYMFLRLGFEGYRRVQQAAH
DVAKYLSGEIAKMDDFTLWNDGSDIPVFAWMLKDKPDRKWNLYDLQDRLRMKGWLVPAYP
MPVDLTQVTVQRIVVRNGFSHDMAESFLKDLKACVKYLDGLKAPMPSEARVSGFHH
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcgataatgcattccaacatcaataccatcgcggcaggttatggttattctggtggt
gccgattccgacagcgtggaagtcaacccactgttcgcccgtccgaaggaagccaaggcc
ttctctaagttcaagattccgcaggaaggaagcctaccggagaccgcctatcaggtggtg
cacgacgacgccatgcttgacggcaacgcacgcctgaacctcgcgaccttcgtaagcacc
tggatggacgattatgcgaaccgcctgtacatggaggcggccgacaagaacatgatcgac
aaggacgagtacccgaagaccgccgaagtcgaatcccgctgctggcatatgctcgccgac
ctctggcatgcgccggacccgatgaataccatcggaacctccaccatcggctcctccgag
gcatgcatgctgggcggcctggccttgaagcgccgctggaaggaagcgcgagaaaaggcc
ggcctgccggccgatcgaccgaatctggtgatgagcagcgccgtgcaggtgtgctgggag
aagttctgcaactacttcgacgtggaaccgcgttacgtgccgatctccgaagagcacaaa
gtgcttgacggctacgacctcgacaagtacgtcgacgagaacaccatcggcgtggtggcc
atcatgggcgtgacctacacgggcatgtacgagccggtcaagaagatctccgacgcgttg
gaccgcatcgaggaacgcaccggactcgatgtgcgcatccacgtggatgccgcttcgggc
ggtatgatcgcaccgttcatccagcccgaccttcagtgggacttccgcgtcaagcgcgtg
tactccatcagtacctccggacacaagtacggtctggtctacccgggcctgggctgggtg
gtatggcgtgagaccgccgacctgccggaaagcctgatcttcaaggtgagctatctgggc
ggcgaaatgccgacctttgcgctgaacttctcccgccccggcgctcaggtgctgttgcag
tactacatgttcctgcgtttgggattcgaaggctaccgccgcgtgcagcaggccgcgcac
gatgtggcgaagtacctgtcgggcgaaatcgccaagatggacgacttcactctatggaac
gacggttccgatattccggtgttcgcttggatgctcaaggacaagccggatcgcaagtgg
aacctgtacgatctgcaggatcgtctgcgcatgaagggctggctagtgccggcctatccg
atgccggtggatctaacgcaggtgaccgtgcagcgcatcgtggtgcgcaacggattcagc
catgatatggccgaatcgttcctgaaggatctgaaggcctgtgtgaagtatctggatgga
ttgaaggcgccgatgccgagcgaggcacgggtctccggcttccatcactga

DBGET integrated database retrieval system