KEGG   Bacteroides dorei HS1_L_1_B_010: EL88_01705Help
Entry
EL88_01705        CDS       T03262                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bdo  Bacteroides dorei HS1_L_1_B_010
Pathway
bdo00500  Starch and sucrose metabolism
bdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EL88_01705
Enzymes [BR:bdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     EL88_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AII61976
UniProt: A0A076IJR8
LinkDB All DBs
Position
complement(424896..427112)
Genome map
AA seq 738 aa AA seqDB search
MKLKKNLSLIAFLCISFIANAQQKLSSPDGNLEMTFTLDGQGTPTYELTYKQKEVIKPSK
LGLELKKEDANAKTDFEWTDKKDIDKLDIKTNLYNGFELKDVQTSTNDETWQPVWGEEKE
IRNHYNELAVTLNQPANDRFIIIRFRLFNDGLGFRYEFPQQKNLNYFVIKEEHSQFAMAG
DHTAYWIPGDYDTQEYDYTVSRLSEIRGLFSKAYTENSSQTAFSPTGVQTALMMKTDDGL
YINLHEAALIDYACMHLNLDDKNMIFESWLTPDAQGDKGYMQTPCTSPWRTVIVSDDARN
ILASRITLNLNEPCKIADTSWIKPVKYIGVWWDMITGKGSWAYTDDLSSVKLGETDYNKT
KPNGKHSANTANVKRYIDFAAEHGFDQVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFNV
KELQSYAASKGVKLMMHHETSASVRNYERHMDQAYQFMADNGYNSVKSGYVGNIIPRGEH
HYGQWMDNHYLYAVKKAADYKIMVNAHEAVRPTGICRTYPNLIGNESARGTEYESFGGNN
VNHTTILPFTRLIGGPMDYTPGIFETRCNKMNPTNNSQVRSTLARQLALYVTMYSPLQMA
ADIPENYERFMDAFQFIKDVAIDWDETKYLEAEPGDYITIARKAKGTNDWYIGCTADENG
HSSKLIFDFLDPDKKYIATVYADAKDADWKDNPQAYTIRKGIVTNKSKLNLHAASGGGYA
ISIKEVKDKSELKGIKRL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaaaagaatctttcacttatcgcatttctctgtatctcattcattgcgaat
gcacaacagaaactgagctctccggatggcaatctggagatgacatttaccctagatggt
cagggcactcctacgtatgaactgacctataaacagaaggaagttatcaaacccagtaaa
ttgggattggaattaaagaaggaagacgcaaacgccaaaaccgacttcgaatggactgat
aaaaaagacatagacaaactggacatcaagacaaacctttataacggtttcgagctaaag
gatgtccagacatctaccaacgatgaaacatggcaaccggtatggggagaagaaaaggaa
atccgtaaccattataatgaattggcggtcacattgaaccagcctgccaatgacagattt
ataatcatccgtttccgcctattcaacgacggtctgggtttccgctatgaatttccgcag
cagaagaacttaaactatttcgtgatcaaagaagaacattcacaatttgccatggcaggt
gaccacactgcttactggattccgggagattacgatacacaggaatatgactataccgtt
tcccgcctgtcggaaatcagaggattgttttcaaaggcttatacggagaactcctcgcaa
acagcattcagccccaccggtgtacaaactgccctgatgatgaaaacagacgatggtctg
tacatcaatctgcacgaagctgctttgatagactatgcctgtatgcacctcaatctggat
gacaagaacatgattttcgaatcatggctgactccggacgcacaaggtgacaaaggatat
atgcagactccctgcacttcaccatggcgtaccgtcatcgttagtgatgatgcccgcaac
attcttgcctcacgcattacgttaaacctgaacgaaccttgcaaaatagcagacacttcc
tggatcaagcctgtgaaatacatcggcgtgtggtgggatatgattacgggaaaaggctca
tgggcttacacagatgacttatccagtgtaaaactaggtgaaacagattacaacaaaaca
aaacctaacggcaaacactctgccaacaccgccaacgtaaaacgttacattgattttgca
gcggagcatggattcgaccaagtattggtagaaggctggaacgaaggttgggaagactgg
ttcggaaaaagcaaagattatgtttttgattttgtaactccctatcccgactttaatgtt
aaagaacttcaaagttacgctgcaagcaaaggtgtaaaactgatgatgcatcatgaaact
tcggcttctgtacgtaactatgaacgccacatggaccaggcataccaattcatggcagac
aacggatataattctgtaaaaagtggctatgtaggcaacattattccacgtggtgagcac
cactatggacaatggatggataaccattatctatatgcggtgaaaaaagcagcggactac
aaaatcatggtaaacgcccacgaagctgtacgccctaccggaatatgccgcacctatccc
aacctgatcggtaacgaatcagcacgcggaactgaatatgagtcatttggcggtaacaac
gtaaaccatactaccatcttgcctttcacacgattaataggtggtccgatggactacact
ccgggtatctttgaaacccgttgtaacaaaatgaatcctaccaacaattcacaggtacgt
tctactttggcacgtcaactggccctgtatgtaacaatgtacagcccattacaaatggct
gctgacatacctgaaaactatgaacgcttcatggatgccttccaattcataaaagatgta
gccattgactgggatgaaaccaaatatctggaagccgaaccgggagactatattaccatt
gcccgcaaagctaaaggaaccaacgactggtatatcggctgtacggcagatgagaacggt
cattcttcaaaactgatatttgatttccttgatccggacaaaaaatacatcgcaactgta
tatgcagacgcaaaagatgccgactggaaagataatccgcaggcatataccatccgtaaa
ggcattgtgaccaacaaaagcaaactgaacttacacgcagcaagcggtggtggttatgca
atcagcattaaagaggtaaaagataaatcagaattaaaaggtattaagaggttatag

DBGET integrated database retrieval system