KEGG   Bacteroides dorei HS1_L_1_B_010: EL88_11090
Entry
EL88_11090        CDS       T03262                                 

Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
bdo  Bacteroides dorei HS1_L_1_B_010
Pathway
bdo00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:bdo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EL88_11090
Enzymes [BR:bdo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     EL88_11090
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 FAD_oxidored GIDA NAD_binding_8 HI0933_like NAD_binding_7 K_oxygenase
Other DBs
NCBI-ProteinID: AII63676
UniProt: A0A076IPG9
LinkDB
Position
2510350..2511297
AA seq 315 aa
MSTEKVKCLIIGSGPAGYTAAIYTGRANIAPVLYEGLQPGGQLTITTEVENFPGYPEGIS
GTQLMEDLRKQAERFGADIRNGIATSADLSKRPYRITIDDEKVIEAETVIISTGATAKYL
GLEDEQKYAGMGVSACATCDGFFYRKKTVAVVGGGDTACEEAVYLAGLAKQVYLIVRKPF
LRASKIMQARVMNHPNIKVLFEHNAVGLYGENGVEGVHLVKRQGECNEERYDLPIDGFFL
AIGHKPNSDIFKDYLDTDEVGYIITEAGTPRTKVPGVFAAGDVADPHYRQAITAAGSGCK
AAIEAERYLSANDLL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagtacagaaaaagttaaatgccttatcatcggctcaggtcctgccggctataccgca
gccatttatacaggacgcgctaacatcgctccggtcttatatgaaggcttacagcccgga
ggccagttgaccatcactaccgaggtggagaatttccccggatatcccgaaggtatcagc
ggtacccagctaatggaggatttgcgcaaacaagcagaacgttttggcgcggatatccgc
aatggtattgcaacttccgccgacctgagcaaacgtccttaccgcatcaccattgatgac
gaaaaagtgattgaggcagaaactgtaattatatccacaggtgccaccgccaaatatcta
ggtctggaagacgaacaaaaatatgccggaatgggtgtaagtgcctgcgccacctgcgac
ggtttcttctatcgcaagaaaactgtagctgtagtaggtggcggtgacactgcttgtgag
gaggctgtctatctggcaggactggccaaacaggtttacctgattgtacgtaaaccgttc
ttacgcgcatccaagattatgcaagcacgtgttatgaaccatcctaacatcaaggtactg
ttcgaacacaacgctgtcggcttatacggagagaatggcgtagaaggcgttcatttggta
aagcgtcagggtgaatgcaacgaagaacgttatgacttgcccatcgacggattctttctg
gctatcggccataagcccaattcagacattttcaaggattatttagacacagacgaagta
ggctacattattacagaagcaggtactccgcgtacgaaagtccccggtgtgttcgctgcc
ggcgatgtggccgacccgcattatcgacaggctatcactgctgctggaagtggctgcaaa
gctgccatagaagcagaaagatacctatctgccaatgacttattataa

DBGET integrated database retrieval system