KEGG   Bacteroides dorei HS1_L_1_B_010: EL88_11150
Entry
EL88_11150        CDS       T03262                                 

Definition
(GenBank) 2-polyprenylphenol hydroxylase
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
bdo  Bacteroides dorei HS1_L_1_B_010
Pathway
bdo00250  Alanine, aspartate and glutamate metabolism
bdo00910  Nitrogen metabolism
bdo01100  Metabolic pathways
bdo01110  Biosynthesis of secondary metabolites
bdo01120  Microbial metabolism in diverse environments
bdo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bdo00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    EL88_11150
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EL88_11150
Enzymes [BR:bdo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     EL88_11150
SSDB
Motif
Pfam: Fer4_20 Pyr_redox_2 DHODB_Fe-S_bind Pyr_redox Pyr_redox_3 NAD_binding_8 AlaDh_PNT_C NAD_binding_1 FAD_binding_2 HI0933_like DAO Thi4 FAD_binding_3 FMO-like Oxidored_nitro Amino_oxidase FAD_oxidored GIDA 3HCDH_N Fer4_18 Lycopene_cycl
Other DBs
NCBI-ProteinID: AII63688
UniProt: A0A4R4HX79
LinkDB
Position
2524007..2526304
AA seq 765 aa
MNKIISKEHFSEKVFKLVIEAPLIAKSRKAGHFVIVRVGEKGERMPLTIAGADPVKGTIT
LVVQEVGLSSTRLCELNEGDYITDVVGPLGKATHIENFGTVVCAGGGVGVAPMLPIVQAL
KAAGNRVITVLAGRTKELIILEKEMRESSDEVIIMTDDGSYGHKGLVTEGVEEVIKRETV
NKCFAIGPAIMMKFVCLLTKKYEIPTDVSLNTIMVDGTGMCGACRITVGGKTRFVCVDGP
EFDGHQVDFDEMLKRMGAFKDIEKEEIHKLDTEKPMTCEATKELDGRDAEWRASLRKAMK
PKERMAIPRVKMNELDAEYRSHSRKEEVNLGLSEEQAVTEAKRCLDCPNPTCMNGCPVGI
NIPKFIKNIERGEFLEAAKTLKATSALPAVCGRVCPQEKQCESQCTHLKAGHEAVAIGYL
ERFAADYERESGQISVPEVAEKNNIKVAVIGSGPAGLSFAGDMAKQGYDVTVFEALHEIG
GVLKYGIPEFRLPNKIVDVEIDNLSKMGVKFMKDCIVGKTISVEDLEAEDFKGIFVASGA
GLPNFMNIPGENSINIMSSNEYLTRVNLMDAASEDSDTPVTFGKRVAVIGGGNTAMDSVR
TARRLGAERAMIIYRRSEEEMPARLEEVKHAKEEGVEFLTLHNPIEYIADEKGRVKQVVL
QKMELGEPDASGRRSPIAIPGATETIDIDMAIVSVGVSPNPIVPSSIPGLELGRKGTIAV
NENMQSSIPTIYAGGDIVRGGATVILAMGDGRKAAASMHAQLSSK
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgaataagattatttcaaaagaacatttctcggaaaaggtctttaaattggttatagaa
gcacctctgattgctaagtcgcgtaaggccggacatttcgtaattgttcgtgtcggtgaa
aaaggagaacgtatgccacttactatcgccggtgccgatcccgtaaaaggtaccatcaca
ctagtagtacaggaagttggtctttcttctacacgactttgtgaattgaacgaaggagat
tatattacagatgttgttggtccgctgggtaaagccacccacattgaaaatttcggaact
gtagtctgtgccggaggaggagtaggcgttgctccgatgcttcctatcgtacaggctttg
aaagctgccggcaaccgtgtaattaccgtattggccggacgtaccaaagaattaattatc
cttgagaaagaaatgcgtgaaagttctgatgaagtaatcattatgacagacgacggctca
tacgggcataaaggattagtgactgaaggtgtggaggaagtaatcaaacgtgaaacagta
aacaaatgtttcgccatcggtcctgccatcatgatgaaattcgtttgcctgctgactaaa
aaatatgaaatacccacagacgtttctctgaacaccattatggtggatggaaccggcatg
tgtggtgcctgccgtatcactgtaggaggcaaaacacgttttgtttgtgttgacggtccg
gaattcgacggccatcaagtagattttgacgaaatgctgaaacgcatgggagctttcaaa
gatattgaaaaagaagaaattcacaaactagacaccgaaaagccaatgacttgtgaagcg
actaaagaactggatggccgggatgccgaatggcgtgcaagcttacgtaaagccatgaag
cctaaagaacgaatggctatccctcgtgtaaaaatgaacgaattggatgcagaataccgt
tcacatagccgtaaggaagaagtcaatctaggcttgagcgaagagcaagctgtaacggaa
gcaaaacgttgtttggactgccccaaccctacttgtatgaacggatgccccgtaggaatc
aatatcccgaaattcatcaaaaatatagaacgcggtgaattccttgaagctgccaaaacc
ttaaaagcaaccagtgcattacctgctgtctgcgggcgtgtatgtcctcaagaaaaacag
tgtgaatcacaatgcactcatctgaaagccggacacgaagccgttgccataggctatttg
gaacgttttgctgctgattacgaacgtgaaagcggtcaaatatccgtaccggaagtagcg
gaaaagaacaatataaaagtagctgttatcggttcaggtcctgccggactctcatttgcc
ggagatatggctaaacagggatacgatgtcactgtattcgaagctttacatgaaatagga
ggcgtattaaaatatggtatccccgaattccgcctaccaaataagattgtagatgtagaa
attgacaatttatccaagatgggtgtcaaattcatgaaggactgcatcgtaggaaagaca
atcagtgtggaagacttggaagcagaagatttcaaaggtatatttgtagcatcaggtgcc
gggctccccaacttcatgaatatcccgggtgaaaattctatcaatatcatgtcttccaac
gaatatctgacccgtgtaaatctaatggatgcagccagcgaggattcggatactcctgta
acattcggcaaacgcgtagcagtaatcggcggtggtaacacagctatggactctgtccgc
acagcacgccgcttaggagcagaacgcgcaatgattatttatcgccgttcggaagaagaa
atgcctgcccgtctggaggaagtgaaacatgctaaagaagaaggtgtggaattcctgact
ctgcataaccccatagaatatattgccgatgaaaaggggcgtgtgaaacaagtcgtttta
cagaaaatggaattaggcgaaccagatgcttccggccgtcgcagtccgatagctattcca
ggagcaacagaaaccattgacatcgatatggcaatagtcagcgtaggcgtctcccctaac
ccgattgttcccagttccatcccgggattggaattgggacgcaaaggaacaattgccgta
aatgaaaatatgcaatcgtcaatcccgactatttatgccggtggcgatattgtgcgtggt
ggagctacagttatccttgcaatgggtgacggacgtaaagcagctgcttccatgcatgca
caactctcctccaaataa

DBGET integrated database retrieval system