KEGG   Bacteroides dorei HS1_L_1_B_010: EL88_19525Help
Entry
EL88_19525        CDS       T03262                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bdo  Bacteroides dorei HS1_L_1_B_010
Pathway
bdo00473  D-Alanine metabolism
bdo01100  Metabolic pathways
bdo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bdo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EL88_19525
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    EL88_19525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bdo01011]
    EL88_19525
Enzymes [BR:bdo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     EL88_19525
Peptidoglycan biosynthesis and degradation proteins [BR:bdo01011]
 Precursor biosynthesis
  Racemase
   EL88_19525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AII65210
UniProt: A0A076ISC4
LinkDB All DBs
Position
complement(4382046..4384511)
Genome map
AA seq 821 aa AA seqDB search
MSSSIENIEKVLGAKRFGNRSAQIDWILTDSRSLCFPEETLFFALKTKRNDGHKYLSELY
ERGVRNFVVGELPADMQSFQDANFLQLTNPLKGLQKLAEKHREQFQIPVIGITGSNGKTI
VKEWLYQLLSPDRVVTRSPRSYNSQIGVPLSVWLMNEHTELAIFEAGISEMGEMEALQTI
IKPTVGILTNIGGAHQENFFSLQDKCMEKLTLFKDCDVIVYDGDNELISSCVAKSLFASR
EIAWSKKDNERPLFIESIQKGEHATTIKYRYLGMPNEFSIPFIDDASIENSLHCLAVALY
MMVPPEQITERMARLEQIAMRLEVKEGKNGCVLINDSYNSDLASLDIALDFMSRRSDDKG
KKRTLILSDMLETGQSSKLLYRQVAELVHSRGVEKIVGVGEEIRTAAARFEIEKYFFRTT
EELLESDLLAGLRNEVILVKGSRAFHFDRISDRLELKVHETILEINLNALVDNLNYYRSK
LKPETKMVCMVKASAYGAGSYEIAKTLQDHRVDYLAVAVADEGSDLRKAGITCSIMIMNP
ELTAFKTMFDYKLEPEVYSFHLLNELIKAAEKEGVTNFPIHIKLDTGMHRLGFAPEEIPE
LIDRLKKQTAVIPRSVFSHLVGSDGAQFDSFTRRQIEMFEAASECLQEAFQHKILRHICN
TAGIERYPGAQFDMVRLGIGLYGIDPFTNQIINNVSTLKTTILQIHEVPKEETVGYSRKG
HLERDSRIAAIPIGYADGLNRRLGNGHAYCLVNGQKASYVGNICMDVCMIDVTDIDCKEG
DKAIIFGDDLPVTVLSEILETIPYEILTSVSNRVKRVYYQN
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcgattgaaaatatagaaaaagttctgggagcaaagcggtttggaaaccgt
agtgcacagattgattggattttaactgatagccgttcattgtgttttccggaagaaaca
ttattttttgctttaaaaaccaaacggaatgacgggcataaatatctttcggaattgtat
gaacgtggagtccgtaactttgtagtgggtgaattgccggctgatatgcaatcttttcaa
gatgcgaatttcctgcagttgaccaatcctctgaaaggattacagaaattggcggaaaaa
catcgggagcagtttcagattccggttataggaattacgggaagtaatggaaaaaccatt
gtgaaggaatggttatatcaattgcttagtccagatcgtgtggtaacccgttcgccacgt
agctataactcacagataggtgtgccactttcggtgtggttgatgaatgagcacactgag
ttggctatttttgaagcgggtatttccgaaatgggtgaaatggaggcgttgcagactatc
attaaacctactgtgggtattttgactaatattggtggtgcgcatcaagagaattttttc
tctttacaggataaatgtatggagaaacttactttgttcaaagactgtgacgttattgtt
tatgatggcgataacgaattgataagttcgtgtgtggcaaaatctctttttgcctcgcgt
gagattgcttggtcgaaaaaggacaatgaacgtccgttgtttattgagtccattcaaaaa
ggagaacatgctaccactattaaataccgttatctggggatgccgaatgaatttagtatt
ccttttatagatgacgcttctattgagaattcgttgcattgtctggctgtggctttgtat
atgatggttccccctgaacaaataaccgagcgcatggcgcgtttggaacagattgctatg
cgtctggaggtaaaagaaggcaagaatggctgtgtgttgatcaatgatagttataattca
gatttggcttctttggatattgctcttgactttatgtcgcgtcgttctgatgataaaggg
aaaaaacggacacttatcctctcggatatgcttgaaacaggacagagcagcaaactactt
tatcgtcaggttgccgaattggtacatagccggggagtagagaagattgtcggggtagga
gaggaaattcggactgctgctgcccgttttgagatagaaaagtatttttttcgtactaca
gaagaattattggaatcggatttgctggccgggctgcgtaatgaggtgattttggtaaaa
ggttcgcgtgcttttcattttgaccggatttcagatcgtttggaactgaaagtgcatgaa
accattttggagatcaatttgaatgctttggttgataacttgaattattatcgcagcaaa
ctgaaaccggaaacaaaaatggtatgtatggtgaaggcttctgcatacggtgccggttca
tacgagatagctaaaacactgcaagatcaccgtgtggattacttggcggtagctgtggct
gatgaaggttcggatttgcggaaagcgggaatcacctgttccattatgattatgaatcct
gagttgacagcattcaagaccatgtttgattataaattggaacccgaggtttacagtttt
catttattgaatgaactgattaaagctgctgagaaagaaggcgtaacgaatttccccatt
catattaaattggatacggggatgcaccgtttgggttttgcacccgaagagattccagaa
ctgatagaccgtctgaagaagcagacagctgttattccacgttctgtattctctcatttg
gtaggcagtgacggggctcagtttgattcgtttacgcgcagacagatagaaatgtttgaa
gctgcttctgaatgtttgcaggaggcttttcagcataagatattgcgtcatatctgtaat
acagccgggatagaacgctatccgggtgctcagttcgatatggtgcgtttgggaatcggt
ctttatggaattgatccgtttaccaatcagattatcaataatgtaagtacattaaaaacc
actattcttcagattcatgaggttcctaaggaagaaacagtggggtatagtcgtaaagga
catttggaaagggattcccgtattgccgctattcctatcggctatgccgacggactgaac
cgacgtttgggaaatggacatgcctattgtttggtgaatgggcagaaagcgtcatacgtg
ggtaatatctgtatggatgtgtgcatgattgatgtgacggatattgattgtaaggaaggg
gataaagctatcatcttcggagatgatttaccggtcactgttctgtcagagattctggaa
actattccatacgagatcttgaccagtgtgtctaatagggtaaaacgagtttattaccag
aattaa

DBGET integrated database retrieval system