KEGG   Bacteroides dorei HS1_L_1_B_010: EL88_22110Help
Entry
EL88_22110        CDS       T03262                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bdo  Bacteroides dorei HS1_L_1_B_010
Pathway
bdo00473  D-Alanine metabolism
bdo00550  Peptidoglycan biosynthesis
bdo01100  Metabolic pathways
bdo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bdo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EL88_22110
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EL88_22110
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EL88_22110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bdo01011]
    EL88_22110
Enzymes [BR:bdo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EL88_22110
Peptidoglycan biosynthesis and degradation proteins [BR:bdo01011]
 Precursor biosynthesis
  Amino acid ligase
   EL88_22110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATP-grasp ATPgrasp_ST TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: AII65680
LinkDB All DBs
Position
5014659..5015633
Genome map
AA seq 324 aa AA seqDB search
MKRTIAIVAGGDSSELVVSLRSAQGLYSFIDKERYNLYIVEMEGHRWEVVLPDGSKTPID
RNDFSFMENGEKKHFDFAYITIHGTPGENGILQGYFDLLGIPYSSCNVLVSAMTFNKFTC
NQYLKGFGIRVAESLILRKGFEITDEEVINKIGLPCFIKPNAGGSSFGVTKVKTKEDIQP
AIEKAFKESDEVMIEAFMRGTEITCGCYKTSDKEVVFPITEVVSANEFFDYGAKYNGESQ
EITPARLPEDTAERVRLLTSAIYDILGCSGLIRIDYIITEGEKVNLLEINTTPGMTATSF
IPQQVRAAGLDIKDVMTDIIENKF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtactattgccatagtagccggaggagattccagcgaacttgtcgtttccctg
cgcagtgcacagggactttactctttcattgacaaagagcgttataacctatatatagta
gagatggaagggcatcggtgggaagtagtccttccggacggttccaaaaccccgatagac
cgtaatgatttcagtttcatggagaacggcgaaaagaaacatttcgacttcgcctacatc
accatccacggaactccgggggaaaacggtatcctgcaaggttacttcgacctgttagga
attccctactccagttgtaacgtactggtatctgccatgactttcaataaattcacctgc
aaccaatacctgaaaggcttcggtatccgcgtagccgaatcactgatcctgcgtaaaggg
tttgaaattacagacgaagaagtaatcaacaaaattggtctgccttgtttcatcaaaccc
aacgccggcggttccagcttcggtgtcaccaaagtaaagactaaggaagatatacaaccc
gccatcgaaaaagctttcaaggaaagtgacgaagtaatgattgaagcctttatgagagga
acggaaatcacctgcggctgttacaagacctcggacaaggaagtggtattccccatcacc
gaggtggtgagtgccaacgaattctttgactatggagccaaatacaatggagaatcacag
gaaatcacccctgcccgcctgcccgaagatacagccgaacgtgtacgtctgctcacttcg
gccatttatgacattctggggtgttccggccttatccgcattgactatatcattaccgaa
ggcgaaaaagtaaacttgctcgaaatcaataccaccccgggcatgacagctaccagcttc
attccccaacaggtgcgtgccgcaggattggatataaaagatgtgatgactgacattata
gaaaataaattttag

DBGET integrated database retrieval system