KEGG   Bacteroides dorei HS1_L_1_B_010: EL88_23365Help
Entry
EL88_23365        CDS       T03262                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bdo  Bacteroides dorei HS1_L_1_B_010
Brite
Translation factors [BR:bdo03012]
 Eukaryotic Type
  Elongation factors
   EL88_23365 (tuf)
 Prokaryotic Type
   EL88_23365 (tuf)
Mitochondrial biogenesis [BR:bdo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    EL88_23365 (tuf)
Exosome [BR:bdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EL88_23365 (tuf)
  Exosomal proteins of breast cancer cells
   EL88_23365 (tuf)
  Exosomal proteins of colorectal cancer cells
   EL88_23365 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AII65911
UniProt: A0A076J1Z5
LinkDB All DBs
Position
complement(5301625..5302809)
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGLSELRSFDSIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVCAATDGPMPQTREHI
LLARQVNVPRLVVFLNKCDMVDDEEMLELVEMEMRELLSFYDFDGDNTPIIRGSALGALN
GVPQWEEKVMELMDAVDTWIPLPPRDIDKPFLMPVEDVFSITGRGTVATGRIEAGVIHVG
DEVEILGLGEDKKSVVTGVEMFRKLLDQGEAGDNVGLLLRGIDKNEIKRGMILCKPGQVK
AHSKFKAEVYILKKEEGGRHTPFHNKYRPQFYLRTMDCTGEITLPEGTEMVMPGDNVTIT
VELIYPVALNVGLRFAIREGGRTVGAGQITELLD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaaatttgaacgttcgaaaccgcacgttaacattggtactatcggtcac
gttgaccacggtaaaaccactttgactgctgctatcactactgtgttggctaaaaaaggt
ctttcagaattgcgttctttcgattctatcgacaacgctcctgaagaaaaagaaagaggt
attactatcaatacttctcacgtagaatatcaaactgcaaatcgtcactatgctcacgtt
gactgtccgggtcacgccgactatgtgaaaaacatggttacgggtgctgctcagatggat
ggtgcaattattgtttgtgctgcaactgatggtccgatgcctcaaactcgtgagcatatt
ctgttggctcgtcaggtaaatgtacctcgtttggtcgttttcttgaataagtgtgatatg
gttgatgacgaggaaatgttggaattggtggagatggaaatgcgtgaattgctttcattc
tatgatttcgatggcgataatactcctatcattcgcggttctgcattaggtgctttgaat
ggtgttcctcaatgggaagagaaagtaatggaattgatggatgcagttgatacgtggatt
ccattgcctccgcgtgatattgataaacctttcttgatgcctgttgaagacgtgttctct
attactggtcgtggtactgttgctacaggtcgtatcgaagctggtgttatccatgtaggt
gacgaagttgaaatccttggtttgggtgaagataagaaatctgttgttactggtgttgaa
atgttccgtaaattgttggatcaaggtgaagctggtgataatgttggtttgttgttgcgt
ggtatcgacaaaaacgaaatcaaacgcggtatgattttgtgtaagccgggtcaggttaag
gctcactctaagtttaaagctgaggtttatatcttgaagaaagaagaaggtggccgtcat
actccgttccacaataaataccgtcctcagttctacttgcgtacaatggactgtacaggt
gaaatcactttgccggaaggaactgaaatggtaatgcctggtgataacgtaactattaca
gttgagttgatttacccggttgcattgaatgtaggtttgcgtttcgctatccgcgaaggt
ggacgtactgtaggtgctggacagataacagaacttcttgactaa

DBGET integrated database retrieval system