KEGG   Bacteroides dorei HS1_L_1_B_010: EL88_23590Help
Entry
EL88_23590        CDS       T03262                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bdo  Bacteroides dorei HS1_L_1_B_010
Brite
KEGG Orthology (KO) [BR:bdo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EL88_23590
Enzymes [BR:bdo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EL88_23590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 FAD_oxidored Thi4 Thioredoxin_3 DAO NAD_binding_7 AlaDh_PNT_C NAD_binding_8 FAD_binding_3 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AII65947
UniProt: A0A4R4I1Y6
LinkDB All DBs
Position
complement(5363652..5365202)
Genome map
AA seq 516 aa AA seqDB search
MLDSAIKDQLKGLFAQLEAHYTFDIFVHPQHESRAELVDLLEEVASCSDKLSCRLQDSEG
LKFILLKEGKDTGITFRAVPGGHEFTSLLMAVLNADGKGKNFPDEFITRRIKALRGPINL
TTYLSLTCTNCPDVVQTLNVMVVLNHQIRHEAVDGAINEDEVNRMKVQAVPTVFADGEQI
HVGRGSIGDLLEKLEARYGSVELEAAETKEYDVLVAGGGPSGTTAAIYSARKGLKVAVIA
ERIGGQVNETMGIENLISIPQTTGKQLAQDLKKHLAEYNIDILENRRIEKVEVAEGMKVL
SVKGGETYKAPVLIIATGANWRKLNVPGEEKYIGHGVAFCPHCDGPFYKGKEVAVIGGGN
SGVEAAIDLAGICSKVTVFEFMDALKADTVLQEKARSLPNVDIFTNTQTVEVLGDGDKVV
GLIKKDRSLEKEEIFALDGIFVQIGLTANSALFKELVETNRMGEILTDKNGRTSVKGIYA
AGDVTDVSYKQIVIAMGEGAKAALAAFEDRMREAIY
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagatagtgcgataaaagatcagttaaaaggtctttttgcccaattggaagcgcac
tatacttttgacatctttgtccaccctcagcacgaaagtcgtgccgagttggtggacttg
ttggaagaagtggcttcctgttcggataaactttcctgtcggttgcaggatagtgaaggg
ctgaagtttatccttttaaaagaaggaaaggatacgggaatcacatttcgtgccgtacct
ggtggtcatgaatttacttctttgttgatggctgttctgaatgctgacggcaaaggaaag
aattttccggacgagtttattaccagacgtatcaaggcattgcgggggcccattaatctg
accacctatttgtctctgacctgtaccaattgtcccgatgtggtccagactctgaatgtg
atggtggttctgaatcatcagatacgtcatgaggcagtggatggggctatcaatgaggat
gaagtgaaccgtatgaaggtgcaggccgttcctactgtgtttgctgatggtgaacaaatt
catgtaggccgtggcagcatcggcgatttattggagaagctggaagcccgttacggctct
gtggaattggaagctgctgagacaaaagaatatgatgttctggtggccggtggtggtcct
tccggaacaacagctgccatctattcggcccgaaaaggattgaaagtagcggtgatagcc
gaacgtatcggtggacaggtaaatgagaccatgggaatcgagaacttgatatctattcct
caaaccaccggtaaacagctggctcaagacttgaaaaaacatttggcggaatataatatt
gatattttggaaaaccgccggatagaaaaggtggaagtggccgaagggatgaaagtactt
tcggtaaaaggtggagaaacctataaggctcccgtactgattattgctacaggggcgaac
tggagaaaattgaatgttcccggtgaagaaaaatacattggtcatggagtggctttctgt
cctcattgtgacgggccgttctataaaggcaaggaagtggcagtcatcggtggtgggaac
tccggagtggaagccgctattgatttggcgggtatctgttccaaagtaaccgtctttgag
ttcatggatgccttgaaagccgatactgttttacaagagaaggccaggagcctgcctaat
gtggatatcttcactaatacccagacggtagaggtattaggagatggtgacaaagtggtg
ggactcataaagaaagatcgttcattggaaaaagaagagatttttgctttggatggtatt
tttgtccagattggtctgactgccaatagtgctttgttcaaagaactggtggaaacgaac
cgcatgggtgaaatcctgaccgacaagaacggacgaacctctgtgaaaggtatctatgct
gctggcgatgtgaccgatgtttcctataagcagatcgtcatagccatgggtgagggtgcc
aaagctgctttagctgcattcgaagaccggatgcgggaagcgatttattag

DBGET integrated database retrieval system