KEGG   Bacteroides dorei HS1_L_1_B_010: EL88_24795
Entry
EL88_24795        CDS       T03262                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bdo  Bacteroides dorei HS1_L_1_B_010
Pathway
bdo00010  Glycolysis / Gluconeogenesis
bdo00020  Citrate cycle (TCA cycle)
bdo00260  Glycine, serine and threonine metabolism
bdo00280  Valine, leucine and isoleucine degradation
bdo00310  Lysine degradation
bdo00620  Pyruvate metabolism
bdo00630  Glyoxylate and dicarboxylate metabolism
bdo00640  Propanoate metabolism
bdo01100  Metabolic pathways
bdo01110  Biosynthesis of secondary metabolites
bdo01120  Microbial metabolism in diverse environments
bdo01200  Carbon metabolism
Module
bdo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EL88_24795
   00020 Citrate cycle (TCA cycle)
    EL88_24795
   00620 Pyruvate metabolism
    EL88_24795
   00630 Glyoxylate and dicarboxylate metabolism
    EL88_24795
   00640 Propanoate metabolism
    EL88_24795
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EL88_24795
   00280 Valine, leucine and isoleucine degradation
    EL88_24795
   00310 Lysine degradation
    EL88_24795
   00380 Tryptophan metabolism
    EL88_24795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bdo04147]
    EL88_24795
Enzymes [BR:bdo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     EL88_24795
Exosome [BR:bdo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EL88_24795
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 NAD_binding_8 HI0933_like FAD_binding_3 FAD_oxidored DAO AlaDh_PNT_C GIDA 3HCDH_N Trp_halogenase Thi4 FAD_binding_2 K_oxygenase 2-Hacid_dh_C Lycopene_cycl NAD_binding_9
Other DBs
NCBI-ProteinID: AII66174
UniProt: A0A076J139
LinkDB
Position
complement(5696750..5698090)
AA seq 446 aa
MKYQIAIIGGGPAGYTAAEAAGKAGLSVVLFEKRSLGGVCLNEGCIPTKTLLYSAKVYDY
AKHASKYAVNVPEASFDLGKIVARKSKVVRKLVLGIKAKLTAHQVNIVTGEAVIVDKNTI
QCGGETYECENLLLCTGSETFIPPIPGVENVDYWTHRDALDNKEVPASLTIVGGGVIGME
FASFFTSLGVQVTVVEMLDEILGGMDKELSAMLRAEYAKKGIKFLLSTKVVGVSKEETGI
TVSYENADGTGTVTADKLLMSVGRRPVTKGFGLENLNLEWTERRCIKVDEHLQSSVPGVY
VCGDLNGVSLLAHTAVREAEVAVHHITGKEDAMSYRAIPGVVYTNPEIAGVGMSEEALQA
AGIPYRAVKLPMAYSGRFVAENEGVNGVCKVLTAEDGTVLGAHMLGNPASELIVLAGMAI
EDGKTIEDWKRYVFPHPTVGEIFREL
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaaatatcaaattgcaatcatcggtggaggtcccgcagggtatactgctgccgaagct
gccggaaaggcaggactgagtgttgtattgttcgaaaaaagaagtttgggcggtgtatgc
ctgaatgagggatgtattcctaccaaaaccttgctttattcggctaaagtatatgattat
gcgaaacatgcttcaaagtatgccgtgaatgtgcctgaagcttcttttgatttaggaaaa
attgtggcgcgtaaatcaaaggtggttcgtaaactggtactgggtatcaaggcaaaactg
actgcgcatcaggtaaatatagtaacgggagaagctgtaattgtagataagaataccatc
caatgtggtggggaaacctatgaatgtgagaatttgctgctgtgtaccggcagtgaaaca
tttattcctcctattccgggagtggaaaatgtggattactggacgcaccgtgatgcactg
gataataaagaagtacctgcttcattgactattgtcggcggtggagtgatcggtatggaa
tttgcttctttctttaccagtttgggagtacaggtgacagttgtcgaaatgttggatgag
atcctgggtggcatggataaagagctgtcggctatgctccgggctgaatatgccaaaaaa
ggaatcaagttcctgctcagtacgaaagtagtaggggtgtccaaagaggaaaccggtatt
actgtgtcatatgaaaatgcagatggaacaggaactgttacagctgataagttattgatg
agtgtgggccgtcgtccggtgacaaaaggtttcggattggaaaatctgaatttggaatgg
acggagcgcagatgcatcaaagtagatgaacatttgcaatcttctgtccccggtgtctat
gtatgcggtgatttgaacggagtctctttgttggcacataccgccgtgcgtgaagcggaa
gtggctgtccatcatattacaggtaaggaagatgcgatgagttatcgtgccataccgggt
gtggtctatacaaatcccgagattgccggggtaggtatgagcgaggaagctttgcaggcc
gcaggtattccttatcgagccgttaagttgccgatggcttactccgggcgttttgtagcc
gagaatgaaggagtgaacggcgtctgcaaagttttgacagccgaagacggtactgtattg
ggagcgcacatgttgggtaatcctgcttccgagctgattgtattggcaggtatggctatt
gaggatggtaagaccatagaggattggaaacgatatgtatttcctcatcctactgtgggt
gagatattcagggaactataa

DBGET integrated database retrieval system