KEGG   Bdellovibrio sp. qaytius: CIK05_11565Help
Entry
CIK05_11565       CDS       T05880                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
bdq  Bdellovibrio sp. qaytius
Brite
KEGG Orthology (KO) [BR:bdq00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    CIK05_11565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB WTF
Motif
Other DBs
NCBI-ProteinID: AZZ37403
UniProt: A0A3T0RTD5
LinkDB All DBs
Position
complement(2401968..2402831)
Genome map
AA seq 287 aa AA seqDB search
MQLIRKMPFAEFRHRFLNAVSNANKHDIFVMASSLAYTTALALAPFLLIILSFASLLSPD
LQQNIYEGLTVAVGDKIADTILAMIENADKHPKLSGMSGVIGVSVLAISASAIFSNLKIA
LDKINEHAFTKEASGLWLFVKGRLFSMGLVFGFSFLSVASLVFTMVIAIFYPDGMGAFWG
FVSFAVNFSVFALVFSAIYRFVPTDRATWKSCIISGVMSTIFYLVGKKLIGLYLGRAGLE
SSYGAAGSLIVLLVWVYYTALTLLFSYEFTRDVILKQDLTTEQNIET
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaattagaaaaatgccgttcgctgagtttaggcatcggtttttaaatgccgta
tcgaacgccaataaacatgatatttttgtcatggccagttcattggcctatacaacggct
ttagccttagcgccgtttctattaattattttatcgtttgcgtcgttgttatcacctgat
ctgcagcaaaatatttatgaaggcttaacagtggctgtcggagataaaattgctgatact
attttggcgatgattgaaaatgcagataagcatccgaagttatcaggaatgtcgggcgtt
attggggtgagtgtgttagcgatttcggcttcggctatattttctaatttaaaaattgct
ctcgataaaattaatgaacatgcctttacaaaagaggctagtggcttatggctttttgta
aagggccgcttattttcaatgggcttagtgtttggtttttcatttttatcagtggcctcg
ttagtttttacgatggtcattgcgattttttatcctgatggcatgggcgctttctggggc
tttgtttcttttgcagttaacttttctgtttttgctttggtgttttcggccatttaccgc
tttgtacccaccgatagagccacttggaaaagttgtattatatcgggcgtgatgagcacg
atcttttatcttgtgggtaagaagttgatcggtttgtatttaggacgagcaggacttgag
tcctcatacggtgcggcggggtcgctgattgttttacttgtttgggtttattataccgct
ctgaccttacttttcagttacgaattcactcgcgatgttattttaaaacaagatctaacc
actgaacagaatatagaaacataa

DBGET integrated database retrieval system