KEGG   Borrelia duttonii: BDU_244Help
Entry
BDU_244           CDS       T00768                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bdu  Borrelia duttonii
Pathway
bdu00564  Glycerophospholipid metabolism
bdu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BDU_244 (glpA)
Enzymes [BR:bdu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BDU_244 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Flu_B_NS1 FAD_binding_3 NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ACH93197
UniProt: B5RL68
LinkDB All DBs
Position
261923..263485
Genome map
AA seq 520 aa AA seqDB search
MLEHKKKVLGDIDNQDFDLIIIGGGATGLGISVDSITRGYKTLLIEKNDYAKGTSSRSTK
LIHGGVRYLAQFNLPLVKEALYEQALLEINAPHIVNKRAFITPMYNILSIPYYYLGLSWY
HNLLGKHKKHKYKTKLLSKSETIKKIPNIKTKGLKCSVLYYDDSFDDARMAISMLRTFIN
KGGNAFNYTELTQFIKKNGKISGAIIRDTITGKQVTVKSKCIINATGIFSDKIRKLDDIN
ASNIIKPSQGTHLIIKKEKLNTQYAMLMPKIADKRILFTVPWYDVIICGSTDIAIDKIEE
EPKRLDSEIEFLLNNMNNYLNIKINRNDILSTYAGIRPLITDPKGQQNTSKISRNEKIFI
SNSNLITIAGGKYTTYRKMAEKALTKAINENLIPAAMPITENLKIHGYMQREEINKIPEH
FRVYGSDFQYLSKMKEFENKIHKELPLNEAQIIFAIEFEQAKTVEDVLSRRTRALLLNAK
ATIEATPKVAEIMMHKLGKSETWKNEQIKNFKKVAKKYLI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacataaaaaaaaagtattgggggatattgataatcaagactttgacttaata
ataattggtggaggagcaacaggccttggcattagtgtagattcgattacaagaggatat
aaaaccttacttatagaaaaaaatgactatgctaaaggcacatcttctcgatcaactaaa
ttaatacatgggggcgtaagatatttagcacaatttaacttacccttggtaaaagaggct
ttatatgaacaagctttgcttgaaataaatgcccctcacatagtaaataaacgtgcattt
attacacccatgtataatattttaagtattccttattactatttagggctcagttggtat
cacaaccttcttggcaaacataaaaaacacaagtataaaacaaaattgctatcaaaatca
gaaacaataaaaaaaataccaaacattaaaaccaaaggtcttaaatgttctgttttatac
tatgatgactcgtttgatgatgccagaatggcaattagcatgcttagaacttttattaat
aaaggaggaaatgcttttaattatacagaacttacacaatttatcaaaaaaaacggtaaa
atatctggtgctattattcgagacacaataactggcaaacaagttactgttaagagtaaa
tgcataataaatgcaacggggatcttttcagataaaattaggaaattagatgacattaat
gcttctaatatcataaaaccttctcaaggaactcatctgataatcaaaaaagaaaaacta
aatacacaatatgcaatgctaatgcctaagatagctgataagagaattttattcaccgta
ccttggtatgatgtcattatctgtggaagtacagatatagcaatagataaaatcgaagaa
gaacccaaaagattagacagtgaaattgaatttttattaaacaatatgaataattattta
aatattaaaataaacagaaatgatattctaagcacatatgcaggaattagaccattaata
acagaccctaaaggacaacaaaacacatccaaaatatcaagaaatgaaaaaatattcata
tcaaactcaaatctcatcacaattgccgggggtaaatacactacctatagaaagatggct
gaaaaagctttaacaaaagcaataaacgaaaatttaatacctgcagcaatgccaataaca
gaaaatttaaaaatacacggatatatgcaacgagaagaaatcaacaaaataccagaacac
tttagagtctatggaagcgattttcaatatttaagtaaaatgaaagaatttgaaaataaa
attcataaagaattaccattaaatgaagctcaaataatttttgccattgaatttgaacaa
gcaaaaaccgttgaagatgttttatccagaagaacaagagcactactcctcaatgcaaaa
gcaacaatcgaagctacaccaaaagttgctgaaattatgatgcataaacttggcaaatct
gaaacttggaaaaatgagcaaatcaaaaactttaaaaaagtagcaaaaaaatatttaatc
taa

DBGET integrated database retrieval system