KEGG   Betaproteobacteria bacterium UKL13-2: AEM42_00480Help
Entry
AEM42_00480       CDS       T04342                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
beb  Betaproteobacteria bacterium UKL13-2
Pathway
beb00550  Peptidoglycan biosynthesis
beb01100  Metabolic pathways
beb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:beb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AEM42_00480
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AEM42_00480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:beb01003]
    AEM42_00480
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:beb01011]
    AEM42_00480
Enzymes [BR:beb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AEM42_00480
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AEM42_00480
Glycosyltransferases [BR:beb01003]
 Polysaccharide
  Bacterial polysaccharide
   AEM42_00480
Peptidoglycan biosynthesis and degradation proteins [BR:beb01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AEM42_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AMS31252
UniProt: A0A142LGA6
LinkDB All DBs
Position
complement(108197..110524)
Genome map
AA seq 775 aa AA seqDB search
MVLRWWFYPLILLGSLVLVALGVVALTLVLLYPNLPSIEAVTDYRPKLPLKVFTVEGDLI
GEFGEEKRSFVKIQDFPPVMKQAILAAEDERFYQHGGVDWLGLTRAGLAALMAGKSKGGA
STITQQVARNFFLTNEVTITRKVSEWLLAYKIESNLSKDQIFEIYLNHIFLGNRAHGFAT
ASRVYFNKDVAQISAAEAAMLAGLPKAPSLYNPFNDLKRATLRQQYVLRRMGELKFLDDA
KLAAARAEVLKFNRERQMYTVSGEHVAEMARQEIFEQYGDKAYVSGIRVTTTVRKADQEA
ATIALRKGVMEYDRRHGYRGPEGFIDLPGKKQDADEAIEDALAEREIIGDLMPAIVIAAD
NKQVVALTKRGETVTMTGDNLKFAVRALAEKAGPGKIIRGSIIRIGLDDKGAPMIAQLPK
VEAAFVSIDPYNGAIRALAGGYDFAANKYNRVTQAMRQPGSSFKPFIYSAALEKGFTPAT
VVNDAPIVFDPGRNSGEVWEPKNYDGKYEGPMRLRQALAKSKNMVSIRVLQAITPQYAQD
YITRFGFEAKQHPAYLTMALGAGSATPLQMAGGYAVFANGGFRITPYFIAKITDDKGNVL
FEANPKRATTDKAATNAAKRVIDPRNAFIMSSMMRDIVRYGTAARAMSLGRNDLAGKTGT
TNDHIDAWFAGFSSTQVGVAWIGYDNPTDLGNSETGGQAALPIWMYYMGRSMKGIQESPF
SPPPGVSVIALGGEGKDGKPATDYVYVENIGSVGEGPSALREANKPSEEVKNQIF
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggtgctccgttggtggttctatccccttatcctgttggggtcgcttgttttggtcgcc
ctcggcgttgtggcgctgacgttggttttgctctacccgaacctgccgtcgatcgaggcg
gtgacggactaccgccccaagctgccactcaaagtctttacagttgaaggcgacttgatt
ggcgagtttggcgaggaaaagcgctcctttgtcaaaatccaagatttccctccggtcatg
aagcaggccattttggctgctgaggatgagcggttctaccagcacggcggcgtcgattgg
ttgggtctcacacgagctggcctagccgcactaatggcgggtaaatcgaagggaggtgca
tcgacaatcacgcagcaagtcgcccgaaacttctttctgactaacgaagtgacaatcacg
cgaaaggtttcggagtggttacttgcttataagattgagtcgaatttgtcgaaggatcag
atttttgaaatctacttaaaccatatttttcttggtaaccgtgctcacggctttgccacg
gcaagtcgggtctatttcaataaagacgttgcacaaatctcggctgcggaagccgcaatg
ctcgcgggattgccaaaggcaccctccctgtataacccgttcaatgacctaaagcgggca
accctcagacaacaatatgttttgcgccgtatgggagagctgaagtttcttgacgacgca
aaacttgccgccgcacgcgcagaggtactgaagttcaatcgcgagcgccagatgtatacg
gttagcggcgaacacgtcgccgaaatggctcgccaagagatctttgaacaatacggtgac
aaagcctacgtcagcggcatccgtgtcaccacgaccgtccgcaaagccgaccaagaagcc
gcgacgattgccctccgcaaaggggtaatggagtatgaccgtcgccatggctatcgtggt
ccggaggggttcatcgacttgccgggaaaaaagcaagacgcagacgaggcaatcgaagac
gcgctcgccgagcgcgagattattggcgacctcatgccggcgatcgtgattgcggcagat
aacaagcaagttgttgccctaaccaaacgtggcgaaaccgtgacaatgaccggcgacaac
ctcaaatttgccgtgcgcgccctcgccgaaaaagcgggccctggaaaaattatccgtggt
tccatcatacgcatcgggctcgatgacaaaggcgcaccgatgattgcacaactacccaaa
gtcgaggcggcgtttgtttcgattgatccatataacggcgcgatccgtgcgcttgcgggt
ggatatgactttgctgcgaataagtacaaccgcgttactcaggcgatgcgacagcctggc
tcatcgttcaagcccttcatttactcggctgcgcttgaaaagggattcacgcccgcaaca
gtcgtcaatgatgcgcccatcgtgtttgacccagggcgcaacagtggcgaggtttgggaa
cccaagaactatgatggcaagtacgaggggccgatgcgtttacgacaggcgctcgctaaa
tcgaagaatatggtttccatccgcgtcttgcaggcaattacgccacagtatgcgcaggac
tacatcactcgatttgggttcgaggccaaacaacatccggcgtatctcaccatggcgctt
ggtgcaggctccgccacgccactgcaaatggcggggggctacgccgtatttgccaacggg
ggcttccgcatcacgccctacttcattgcaaagattaccgatgacaagggcaatgttttg
tttgaagccaatcccaagcgtgccacgacagacaaggctgctaccaatgcagccaaacga
gtcattgacccgcgcaatgcgtttattatgagttcgatgatgcgcgatattgtccgctat
ggaacggcggcacgcgccatgagcttgggtcgtaacgatcttgcaggaaagacgggcacc
accaatgaccacattgatgcgtggttcgccggatttagttcaacgcaagtgggggttgca
tggattggttatgacaatcccaccgaccttggcaacagcgaaactggaggacaggccgcg
ctgccaatttggatgtactacatggggcgcagcatgaagggtattcaggagtcgccattt
tccccgccgcccggcgtttccgtgattgcgctgggcggcgaaggaaaagacggtaaacct
gcaactgattatgtttacgttgaaaatatcggtagcgttggcgaaggtccatctgcgctt
cgcgaggcgaataaaccttccgaagaagtcaaaaatcaaattttctga

DBGET integrated database retrieval system