KEGG   Betaproteobacteria bacterium UKL13-2: AEM42_08245Help
Entry
AEM42_08245       CDS       T04342                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
beb  Betaproteobacteria bacterium UKL13-2
Brite
KEGG Orthology (KO) [BR:beb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:beb01001]
    AEM42_08245
Enzymes [BR:beb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AEM42_08245
Protein kinases [BR:beb01001]
 Serine/threonine kinases: Other
  Bacterial family
   AEM42_08245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr cNMP_binding APH Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AMS32382
UniProt: A0A142LJI6
LinkDB All DBs
Position
complement(1831334..1832668)
Genome map
AA seq 444 aa AA seqDB search
MNMDRPQRLGKYALLSELGRGATAVVYLAEDTFNNRKVAIKLQVKDESAGPEEARRFEKL
FLNEAAMFGKLSHPNIVAVYDAVVEGEQQYIVMEWVGGGSLKKFCTETNLLPVRQAVLVI
FKACRALDYAFQNGVIHRDIKAANILLSDRDEIKISDFGTAQISQAMHTQIDGFVGSPAY
MAPEQINEEPPSVQTDIYSLGVTFYELLTGRLPYQGTNTVSMINKILNEDPTPIRSIRPD
LPEPIVKIVEKAMAKDPAKRYQAWYDMASDLADTFPQLEKYSFEISSVEKFNALRKLEFF
KDFRDAELWEVLRGAMWENHAREESLLLEGDVGHAFFIIVTGQVKVMKDGQLLNVLRDGD
CFGEMAYLSGDKARRSATISAVSEVQLIKIQDVQLEHLSEACQLRFNRVFLRTLIERLTW
TSDALAQQAENRSPTHPPPNEPLT
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggaccgaccacagaggctcggaaagtatgcgttgttgtctgaattggggcgc
ggtgccacggccgtggtctatttggccgaagatactttcaataaccgcaaagttgcgatc
aagttgcaggtcaaggatgagtcagccggacccgaagaagcgcgtcggttcgagaagttg
tttctcaatgaagccgcgatgttcggcaagctctcacatcccaatattgtcgcggtgtac
gatgcggttgtcgaaggggagcagcagtacatcgtcatggaatgggttggtggcggtagt
ctgaagaaattctgtaccgagaccaacctactaccggttcgtcaggccgtactggtgatt
ttcaaggcctgccgtgcgcttgattacgccttccaaaacggtgtgattcatcgcgatatt
aaggcggccaatatcttgttgtccgaccgcgacgaaatcaaaatttccgactttggaacg
gcacagatctcccaagcgatgcatacgcagattgacggctttgtcggctcgcccgcatac
atggcgccggaacaaatcaatgaggagccgccgtcggttcaaaccgatatctattcgctc
ggtgtcacgttctacgaattgctgacgggccgcttgccctaccaagggacgaataccgta
tcgatgatcaacaaaattttgaatgaagaccctacgcccattcgcagtatccggcctgac
ctgcccgagccaatcgtcaagattgtcgagaaggcaatggcaaaagaccccgccaaacgc
taccaggcatggtacgacatggcgtccgatctggcagatacattcccccagctcgaaaaa
tactcattcgagatttcttctgtggagaaattcaatgcactgcgcaaactcgaatttttc
aaagatttccgtgacgccgaattgtgggaggtgcttcgcggtgcaatgtgggaaaaccat
gcgcgtgaggagagccttttgctcgaaggcgatgtcggccatgcattctttatcatcgtc
accggccaagttaaggtgatgaaagacgggcaattgttaaacgtgctgagggacggcgac
tgcttcggcgaaatggcatatttatcgggcgataaggcacgccgctcggccaccatatcg
gcggtgtcagaagtgcaattaatcaagattcaggatgtacaacttgagcacttgtctgaa
gcctgtcagttacgcttcaaccgcgttttcttgcgcaccctgatcgagcgcctgacttgg
acgagcgacgcgctcgcgcaacaggcggaaaatcgctcacccactcacccgcctccgaac
gagcccctcacatag

DBGET integrated database retrieval system