KEGG   Betaproteobacteria bacterium UKL13-2: AEM42_08340Help
Entry
AEM42_08340       CDS       T04342                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
beb  Betaproteobacteria bacterium UKL13-2
Brite
KEGG Orthology (KO) [BR:beb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AEM42_08340
Enzymes [BR:beb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AEM42_08340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_3 FAD_binding_2 Thi4 DAO NAD_binding_8 K_oxygenase AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AMS33728
UniProt: A0A142LND2
LinkDB All DBs
Position
1854922..1856523
Genome map
AA seq 533 aa AA seqDB search
MLDQQLKDQLQAYLGKIRHPITLTASLDETQGSQEMRELLHEIASLSDQVMVDESGTDTR
KPSFVIAPSGQAHGVRFAAIPLGHEFTTLVLALLWTGGHPPKLGQEVIDRIVSLDTDCDF
EAYISLSCHNCPDVAQALAVMATLNPRINATIIDGGLFQSEVESRNVMAVPKVYLNGQDF
GSGRMLIEEIIAKLDVNGEAREAAALTAKAPYDVLIVGGGPAGAAAAVYAARKGIRVGVA
AERFGGQTNDTLGIENYPSVLETNGPKFAAALEAQVKHYEVDVMNLQRAEKLVPATNENG
LIEVHLVNGAVLKTKTVILSTGARWRNINVPGEDQYKNKGVAYCPHCDGPLFKGKHVAVI
GGGNSGVEAAIDLAGVVGHVTLFEFAEALKADAVLVRKLQSLANVTIHTNAQTTEITGNG
SRVNGLTYKERTTGDIKHVALEGVFVQIGLVPNTEWLTGNVELSRFGEIVVDAKGATSVP
GVFAAGDCTVTPYKQIVIAAGEGAKAALSAFDHLIRLPVAERPKMAAAATSAH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccaacaacttaaggatcagctacaggcttacttgggcaagattcggcacccc
attacgctgacggcgtccctcgatgaaacccaaggttcgcaagaaatgcgcgagctgttg
catgagatcgcttcgctctctgatcaggtgatggtggatgagtcaggcacagacactcgc
aaacccagctttgtcatcgccccaagcgggcaggcgcacggtgtacgttttgcggcgatt
ccactcgggcatgaattcaccacgcttgtactcgcattgctgtggaccggcgggcaccca
cccaagcttggtcaagaggtcattgaccgcatcgtgtcgctcgacactgattgtgatttc
gaggcatatatcagtttgtcttgccataactgcccggatgtcgcacaagcattggctgtg
atggcgacgctcaatccgcgcatcaatgccaccatcattgacggggggctatttcagagc
gaagtagaaagccgcaacgtgatggcggtgccgaaggtgtacctgaatgggcaagacttt
ggatcgggtcgtatgttgatcgaagagatcatcgccaaacttgatgtgaatggtgaagcg
cgcgaagcggcagcgttaacagcaaaagcgccatacgatgtgttgattgtcggcggtgga
cctgcaggtgcggcggcagccgtgtacgccgcacgcaagggtattcgtgtgggtgtggca
gcagagcgttttggtggccaaaccaatgacactcttggtattgaaaactatccttccgtc
ctcgaaacaaatgggcctaagtttgcggctgcacttgaagcgcaggtgaagcactatgaa
gttgatgtgatgaacttgcagcgtgccgagaaattagtgccagccactaacgagaacggc
ctcatcgaagtgcatctggtgaatggtgcggtgctcaagactaagacggttattctttcg
acgggtgcgcggtggcgaaacatcaatgtgccgggtgaagaccagtacaaaaacaaaggt
gttgcgtactgcccccactgtgacggcccattgttcaaaggtaaacacgttgccgtcatt
ggtggcgggaattcaggtgtagaagcggctattgacttggcgggtgtggtcgggcatgtg
acgttgtttgaatttgctgaggcattgaaagccgatgcggtgttggtacgcaagctgcaa
agcctagcgaatgtcaccatccacaccaacgcgcaaacgactgaaatcaccggcaatggc
agccgtgttaacggtttgacctacaaagagcgtaccaccggcgacatcaaacacgtagca
ttggaaggcgtgtttgtgcagattggtctggtccccaatactgaatggctgacgggcaat
gttgagttgagccgtttcggtgagattgtggttgacgcgaagggggcgaccagtgtgccg
ggtgtctttgcggccggcgattgcacggtgacaccgtataagcaaatcgtgattgcggca
ggcgagggcgcgaaggcggcattgagcgccttcgaccatctgattcgcttgccagtcgca
gaacgcccgaaaatggcggcggcagcgacatcggcgcattag

DBGET integrated database retrieval system