KEGG   Betaproteobacteria bacterium UKL13-2: AEM42_08845Help
Entry
AEM42_08845       CDS       T04342                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
beb  Betaproteobacteria bacterium UKL13-2
Pathway
beb00061  Fatty acid biosynthesis
beb00780  Biotin metabolism
beb01100  Metabolic pathways
beb01130  Biosynthesis of antibiotics
beb01212  Fatty acid metabolism
Module
beb_M00083  Fatty acid biosynthesis, elongation
beb_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:beb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AEM42_08845
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AEM42_08845
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AEM42_08845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:beb01004]
    AEM42_08845
Enzymes [BR:beb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AEM42_08845
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AEM42_08845
Lipid biosynthesis proteins [BR:beb01004]
 Fatty acid synthase
  Component type
   AEM42_08845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AMS33743
UniProt: A0A142LNE7
LinkDB All DBs
Position
complement(1981033..1981815)
Genome map
AA seq 260 aa AA seqDB search
MGFLANKKILVTGLLSNRSIAYGIAKAMHREGAELAFTYAGDGIKDRVHKLVPDFGGNIV
LPCDVTRDDEIAACFDSLKAEWGTFDGFVHAIAFAPKEAIMGDFLDGLSRESFRMAHDIS
SYSYAAMAKAALPMMNPTAALLTLSYLGAERVVPNYNTMGTAKASLEAVTRYLAASLGPR
GIRANAISAGPIKTLAAAGIAGFREMLGFFEEHAPLRRGVTQEEVGNVAAFLMSDLASGI
TGEVTYVDAGFNTVVAGMPH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgggttttcttgcaaacaaaaaaattctggtgacggggctgttgtccaaccgctcaatc
gcctacggtatcgccaaggcaatgcatcgcgaaggtgctgaattggcctttacctacgcc
ggggatggcatcaaagatcgagtacataagctggtgccagatttcggcggcaacattgtg
ctgccctgtgatgtcacacgcgacgacgaaattgcagcgtgttttgacagcctgaaggcc
gaatggggaaccttcgatggcttcgtccacgccattgcattcgcgccgaaggaagccatc
atgggcgactttttggacggtctctcgcgcgagagttttcgtatggcgcacgacatctcc
agctatagctatgcggcgatggccaaagccgcactgccaatgatgaacccgacggcggcg
ctgctcacactctcatatttgggcgctgagcgtgtggtgccgaactacaacaccatgggc
acggccaaagcgagccttgaggccgtcacccgttacctcgccgccagccttgggccgcgc
ggtattcgtgccaacgccatctcggccgggccgatcaagacactcgccgcggctggaatc
gcggggttccgcgagatgctcggattctttgaagagcacgcgccgcttcggcgcggtgtg
acccaagaagaagtcggcaacgtcgccgcgtttctgatgagcgacttggccagcggcatc
acgggcgaggtcacatacgtcgatgcggggttcaacaccgtcgtcgccggaatgccgcac
tag

DBGET integrated database retrieval system