KEGG   Betaproteobacteria bacterium UKL13-2: AEM42_09050Help
Entry
AEM42_09050       CDS       T04342                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
beb  Betaproteobacteria bacterium UKL13-2
Brite
Enzymes [BR:beb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AEM42_09050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5
Motif
Other DBs
NCBI-ProteinID: AMS32489
UniProt: A0A142LJU3
LinkDB All DBs
Position
2021786..2022319
Genome map
AA seq 177 aa AA seqDB search
MIKPVLVKSGTGVFAVLLLSGCVSMSSDGPSAVAMLQPTKGSQTTGTVTFTQVGNKVRVV
ADVKGLKAGAEHGFHIHEKGDCSSGDGMSTGGHFNPGGKGHAHHSSSERHAGDMPSLLAD
AQGNAKLSVTLDLLMVAPGATSVVGRGLIVHRDPDDYKTQPTGNAGPRIACAVIAAK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacccgtgttggtgaaaagtggcaccggtgtatttgccgtgctcctgctgtca
ggatgtgtaagcatgtcttccgatgggccatcggcggtagcaatgctgcagcccaccaaa
ggcagtcaaaccacgggcacggtaacgtttacgcaagtcggcaacaaggtgcgggtggtt
gctgacgtgaaaggacttaaggcgggcgcagagcacggttttcacatccacgaaaagggt
gattgcagctctggtgatggcatgagtacgggtggacatttcaacccgggcggtaaaggc
cacgcgcaccacagtagctcggaacgccatgccggtgacatgccatcacttcttgctgac
gcgcaaggtaacgcaaagctctccgtcacgctcgatctgctgatggtggctcccggcgcg
accagtgtggttggccgtggcttaatcgtgcaccgtgatccggacgattacaagacgcag
ccaacggggaacgctggcccccgcatcgcttgtgcggtgatcgccgcaaaatag

DBGET integrated database retrieval system