KEGG   Betaproteobacteria bacterium UKL13-2: AEM42_12535Help
Entry
AEM42_12535       CDS       T04342                                 

Definition
(GenBank) hypothetical protein
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
beb  Betaproteobacteria bacterium UKL13-2
Pathway
beb00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:beb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AEM42_12535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:beb01002]
    AEM42_12535
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:beb01011]
    AEM42_12535
Enzymes [BR:beb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AEM42_12535
   3.4.21  Serine endopeptidases
    3.4.21.-  
     AEM42_12535
Peptidases [BR:beb01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   AEM42_12535
Peptidoglycan biosynthesis and degradation proteins [BR:beb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AEM42_12535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AMS32994
UniProt: A0A142LL98
LinkDB All DBs
Position
complement(2800485..2801972)
Genome map
AA seq 495 aa AA seqDB search
MWAAISGQATAQLPARVSEMLRISNMPETALGVAVIRLADGKLVWSQYPSQSMQPASTIK
VLTAIVGLDKLGPAYRSRTEISTSAPIVGDQLNGDLVIRGEGNTDISWEDFSRMLQAVRQ
SGIREIRGNVVIDRTFFNPSRLDIGVPPFDETPEFRYNVIPDALLINMNLAQFDIASTDN
ALTVRLTPQLSGVKVISNMSLIARACEKWEEGWKRPTTVYADDGEIRVHLEGEFPQNCAI
TTNLNVIDRAEYTSRLFRNLWTTLGGAHTGRIIEAPPPSTLTATIPTAESPVGTRRVLAE
HRARPLAEVSRNINKVSDNAITRMVFLTLGARADATVVADKDGSLDVPTIVKGEQVVRKW
LQSQQIDDADVVLDNGSGLSRRERISPKQLAAVLAAAHRSKWAPEFLSSLPIVAVDGSMR
SRLKDSPAAETARIKTGGLRNVVSVAGYVTNVAGEVHAVVGMVNHDRAALAGGRAILDAL
LDEVARSNATPVLTK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcggcaatttctggtcaggcgaccgcgcaactgccggcccgggtcagtgagatg
ttgcgtattagcaacatgcctgagacggcgctcggcgttgctgttattcgtctggccgat
ggaaagctcgtctggtctcagtacccgagtcagtcgatgcagccggcctccacgatcaag
gtgctgaccgccatcgttgggctagacaagctgggacctgcgtaccggagtcgtaccgag
atttcgacctctgcgccaatcgtcggcgatcagttgaacggcgacttggtcatccgtggc
gagggcaacaccgatatttcttgggaagacttctcgcgaatgttgcaggcggtgcgtcaa
tctggcatccgcgaaatacgcggaaatgtggtgatcgaccgaacgttcttcaacccgtcg
cggctcgacatcggcgtgccgccgtttgatgaaacaccggaatttcgctacaacgtcatc
ccggatgcgttgttaatcaacatgaacttggcgcaatttgatatcgcgtcgacggacaac
gcgctcaccgttaggctcacaccacaattgtctggcgtaaaggtcatttccaatatgtcg
ctcatcgcgcgcgcttgtgaaaaatgggaagaggggtggaagcggccgaccacagtctat
gccgatgacggcgagattcgggtacacctagaaggcgagtttccgcagaactgcgccatc
accaccaacctgaacgtgattgatcgcgccgaatatacgtcgcgacttttccgcaatcta
tggacgacactcggcggcgcgcacactggtcgcattatcgaggcaccaccgccatcgaca
ctgaccgcgacgataccgacggcagaaagtccagtcggtaccagacgggtattggccgag
caccgcgcccgcccgctcgccgaggtcagtcgcaatatcaataaagtttctgacaacgcc
atcacgcgcatggtgttcctcacgctaggcgcgagggcggatgcgactgtggtggcagac
aaagatggatcgctggatgtgccgacgattgtcaaaggtgagcaggttgttcgtaaatgg
ctgcaatcgcaacaaattgatgatgctgatgtagtcttggacaatggctcgggactttcc
cgtcgcgaacgcatttcgccgaagcaactcgcggcagtgctggccgcggcgcaccgtagc
aagtgggcaccggagtttttgtcgagccttcccatcgttgcggtggatggctcgatgcgt
agccgattgaaggatagccccgcagcggagacggcgcgcatcaaaaccggcggcttacgc
aatgttgtgtcagtcgcaggatatgtcaccaatgtcgctggcgaggttcatgccgtggtt
ggcatggtcaaccatgatcgtgctgcgctggcgggtggacgcgcgatactggacgccttg
ctcgatgaagtcgcacggtcaaacgcgaccccggttttgactaagtag

DBGET integrated database retrieval system