KEGG   Betaproteobacteria bacterium GR16-43: BWI17_02410Help
Entry
BWI17_02410       CDS       T04726                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
beba  Betaproteobacteria bacterium GR16-43
Brite
KEGG Orthology (KO) [BR:beba00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:beba01001]
    BWI17_02410
Enzymes [BR:beba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BWI17_02410
Protein kinases [BR:beba01001]
 Serine/threonine kinases: Other
  Bacterial family
   BWI17_02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Haspin_kinase RIO1 Seadorna_VP7 Kinase-like
Motif
Other DBs
NCBI-ProteinID: APV48637
UniProt: A0A1P8FEU0
LinkDB All DBs
Position
complement(476380..477543)
Genome map
AA seq 387 aa AA seqDB search
MEQPALPEKFGRFRVISELGRGAMGVVYCAGDPSLGRTVAIKTIALTGNARERDIHEARF
LQEARAAGGVSHPAVITIYDVGREGDVAFIAMELLEGNELRDLIRWGTLTPSQAVNIAAT
VAEGLAVAHEKRVVHRDIKPGNIMVLKDGRVKLMDFGIARLHENAVKTQTGTLLGSPQYM
SPEQIAGREVDARADIFSLGVVLYEMLTGAKPFAGEDVSALLFSIANMQAKPPRHLQPTL
PSVLDYIVARALKKDPADRYQSAIEFASDLRSCAAEVAEAEALARVKPAEGSSTIPNTPP
APHDVEPRSRPLSLSEDQMALRPSPRFDSTEGLARLAVIPADQSDTKSRAGWTMPVPRLA
RRQDPARLKVLGAYAAATGLAILIILI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcccgcgctcccggaaaaattcggccgcttccgggtcatctcggagctcggc
cgcggcgccatgggcgtggtgtattgcgcgggcgatccgtcgctcggccgcacggtggcg
atcaagaccatcgcgctcaccggcaacgcgcgcgaacgcgacatccacgaggcgcgcttc
ctgcaggaggcgagggccgcgggcggcgtgagccatcccgcggtgatcacgatctacgac
gtcggccgcgagggcgacgtggcgttcatcgcgatggagctgctcgagggcaacgagctg
cgcgacctgatccgctggggaaccctcacgccgtcgcaagcggtcaacatcgcggccacc
gtggccgaggggctggccgtcgcgcacgagaagcgcgtggtccaccgcgacatcaagccc
ggcaacatcatggtgctgaaggacggccgcgtgaagctgatggacttcggcatcgcgcgc
ctgcacgagaacgcggtgaagacgcagaccggcacgttgctgggctcgccccagtacatg
tcgcccgagcagatcgcgggccgcgaagtcgacgcgcgagccgacatcttctcgctcggc
gtggtgctctacgagatgctcacgggggcgaagccgttcgcgggcgaggacgtctcggcg
ctgctcttctccatcgccaacatgcaggccaagccgccgcgccacctgcagcccacgttg
ccctcggtgctcgactacatcgtggcgcgcgcgctgaagaaggacccggccgaccgctac
caatccgcgatcgagttcgcgtcggacctgcgctcgtgcgccgccgaggtggccgaggcc
gaagcgctcgcgcgcgtgaagccggccgaggggtcgagcaccatccccaacacgcccccc
gcgccgcacgacgtcgagccgcgctcgcgccccctgtccctctcggaagaccagatggcg
ctgcgtccttcgccgcgcttcgattccaccgagggcctcgcgcgcctcgcggtgatcccc
gccgaccagtcggacacgaagtcgcgcgccggctggaccatgcccgtcccgaggctcgcg
cgccgccaggatcccgcgcgcctgaaggtgctcggcgcctatgcggcggccaccggcctc
gccatcctgatcatcctgatctag

DBGET integrated database retrieval system