KEGG   Betaproteobacteria bacterium GR16-43: BWI17_10645Help
Entry
BWI17_10645       CDS       T04726                                 

Definition
(GenBank) tRNA epoxyqueuosine(34) reductase QueG
  KO
K18979  epoxyqueuosine reductase [EC:1.17.99.6]
Organism
beba  Betaproteobacteria bacterium GR16-43
Brite
KEGG Orthology (KO) [BR:beba00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:beba03016]
    BWI17_10645
Enzymes [BR:beba01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.6  epoxyqueuosine reductase
     BWI17_10645
Transfer RNA biogenesis [BR:beba03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BWI17_10645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1730 Fer4_16 Fer4_10 Fer4_7 Fer4_9 Fer4_6 Fer4_21 Fer4_8 Fer4 Fer4_18
Motif
Other DBs
NCBI-ProteinID: APV50101
UniProt: A0A1P8FJ11
LinkDB All DBs
Position
complement(2143130..2144185)
Genome map
AA seq 351 aa AA seqDB search
MQRQADMRVEDRIRQWGRELGFDAVAIAGTSLDDEEARLLDWLGRGWHGGMDYMARHGAR
RARPAELVPGTLSVISVRLNYTPPAARDSWETLADAKSAFISRYALGRDYHKVLRNRLQS
LADRMTAELGAFHYRVFTDSAPVMEVALAARAGLGWRGKHTLLLSRDAGSLFFLGEMFVA
LDLEKGEPVTEHCGTCTRCIDICPTQAIVAPYQLDARRCISYLTIENDGPIPEELRPLMG
NRIYGCDDCQLACPWNKYASLAALPDFAVRNELDSASLVALFAWTPDEFDQRLQGSAIRR
IGHERWLRNIAVALGNAPATQEIAAALESRRQDPSALVREHVEWALARHKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggcaagccgacatgcgcgtggaggaccggatccgccaatggggccgcgagctg
ggcttcgacgcggtcgccatcgcgggcacgagcctggacgacgaggaagcgcggctgctc
gactggctcggccgcgggtggcacggcggcatggattatatggcacgccatggagcgcgc
cgcgcccgtccggccgagctcgtgcccggaacgctgagcgtgatcagcgtgcgcctcaac
tacacgccgcccgcggcacgcgattcgtgggagacgctggccgacgcgaagagcgccttc
atctcgcgctatgccctcggccgcgattaccacaaggtccttcgcaaccggctgcagtcg
ctggccgaccggatgaccgccgagctgggcgcattccactatcgcgtgttcaccgacagc
gcacccgtgatggaggtggcgctcgccgcgcgcgcgggcctcggctggcgcggcaagcac
acgctgctgctctcgcgggatgcgggctcgctcttcttccttggcgagatgttcgtcgcc
ctcgatctcgagaagggcgaaccggtcaccgagcactgcggcacgtgcacgcgctgcatc
gacatctgccccactcaggcgatcgtcgcaccctaccagctcgatgcgcgccgctgcatt
tcctacctcacgatcgagaatgacggacccatccccgaggaactaaggcccctgatgggc
aatcgtatctacggttgcgacgactgccagctcgcctgtccctggaacaagtacgcgagc
ctggccgcgctgccggatttcgcggttcgcaatgaactcgacagtgcgagcctcgtagcg
ttgtttgcatggacgccggacgagttcgaccagcgcttgcaaggctcggccatccggagg
atcggacacgagcgctggctgcggaacatcgcggtggcgctcgggaatgcacccgccacg
caggagatcgcggcggcactcgaatcccggcggcaggatccctccgccctcgtgcgcgag
cacgtggagtgggcactagcacgccacaaagcttga

DBGET integrated database retrieval system