KEGG   Betaproteobacteria bacterium GR16-43: BWI17_13455Help
Entry
BWI17_13455       CDS       T04726                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
beba  Betaproteobacteria bacterium GR16-43
Brite
Enzymes [BR:beba01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BWI17_13455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-ProteinID: APV50606
UniProt: A0A1P8FKI1
LinkDB All DBs
Position
2775371..2775913
Genome map
AA seq 180 aa AA seqDB search
MVRIAFTLAVATLAAGCAGTSPGSAATASNTGATAVAKLESTKGNAVAGTATFVQRGDEV
YVTVNVTGLPPNTSHGFHVHEKGDCSSGDGMSTGGHFNPTGAPHAKHEAAAHHAGDLPSL
TADAYGNASINFKSKTITVGSGITDVIGRGLIVHRDPDDYTTQPTGNAGPRVACAVIQKA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggtccgaatcgctttcacgctcgctgttgccacgctcgctgccggttgcgccggaacg
tcccctggttccgccgccacggccagcaacaccggggcgaccgccgttgcgaagctcgaa
tccacgaagggcaacgccgtcgccggcaccgcgacgttcgtgcaacgtggcgacgaggtg
tacgtcacggtcaacgtgacgggacttccgccgaatacgtcgcatgggttccacgtccac
gagaagggcgactgcagttccggcgacgggatgagcacgggcgggcacttcaatcccacg
ggcgcgccgcacgccaagcacgaggccgccgcacaccacgccggcgacctgccgagcctc
accgcggacgcctacggaaacgcctcgatcaatttcaagtcgaagaccatcacggtgggt
agcggcatcacggacgtgatcggccggggactcatcgttcaccgcgatccggacgactac
acgacccagccgaccggcaatgccggcccgcgcgtggcgtgcgccgtgatccagaaggcc
tag

DBGET integrated database retrieval system