KEGG   Betaproteobacteria bacterium GR16-43: BWI17_17685Help
Entry
BWI17_17685       CDS       T04726                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
beba  Betaproteobacteria bacterium GR16-43
Pathway
beba00020  Citrate cycle (TCA cycle)
beba00270  Cysteine and methionine metabolism
beba00620  Pyruvate metabolism
beba00630  Glyoxylate and dicarboxylate metabolism
beba00680  Methane metabolism
beba01100  Metabolic pathways
beba01110  Biosynthesis of secondary metabolites
beba01120  Microbial metabolism in diverse environments
beba01130  Biosynthesis of antibiotics
beba01200  Carbon metabolism
Module
beba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
beba_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
beba_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:beba00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BWI17_17685
   00620 Pyruvate metabolism
    BWI17_17685
   00630 Glyoxylate and dicarboxylate metabolism
    BWI17_17685
  Energy metabolism
   00680 Methane metabolism
    BWI17_17685
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BWI17_17685
Enzymes [BR:beba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BWI17_17685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: APV51358
UniProt: A0A1P8FMS6
LinkDB All DBs
Position
complement(3757139..3758122)
Genome map
AA seq 327 aa AA seqDB search
MKKPMRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEIPDEKAQKALKGVMMELD
DCAFPLLQSMVGTSDATAAFRDVDVALLVGARPRGPGMERKDLLEANGAIFVPQGKALGE
VASRDVKVLVVGNPANTNSLIAMKNAKGLKPQQFTAMMRLDHNRALTQVAQKTGKAVTDV
KKMSIWGNHSATQYPDVFHAEVAGKNAAQTINDQAWIEGTFIPTVQKRGAAIIDARGLSS
AASAANAAIDHVRDWVLGSTEWVSMGVPSDGSYGIPEGIIFGYPCTTANGQYTIVKGIEH
NDFAKAKIAATQKELEEERAAIAHLLK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcccatgcgcgtcgccgtcaccggcgccgcaggccagatcggctacagcctg
ctgttccgcattgccagcggcgagatgctcggcaaggaccagcccgtcatcctccagctg
ctggagatccccgacgagaaggcccagaaggcgctgaagggcgtgatgatggagctggac
gactgcgcgttcccgttgctgcagtccatggtgggcacgtcggatgccacggctgcgttt
cgcgatgtggacgtggccctcctcgtgggcgcgcgtccccgcggcccgggcatggaaagg
aaggacctcctcgaagccaacggcgccatcttcgtgccgcagggcaaggcgctgggcgaa
gtggcctcgcgcgacgtgaaggtgctggtcgtgggcaacccggccaacacgaactcgctc
atcgcgatgaagaacgcgaagggcctgaagccccagcagttcacggcgatgatgcgcctc
gaccacaaccgggcgctgacgcaggtggcgcagaagaccggcaaggccgtgaccgacgtg
aagaagatgtcgatctggggcaaccactcggccacgcagtatccggatgtcttccatgcg
gaagtcgcgggcaagaacgccgcgcagaccatcaacgaccaggcctggatcgagggcacg
ttcatcccgacggtgcagaagcgcggcgcggccatcatcgatgcgcgcggcctttcgtca
gcggcttcggcggccaacgcggccatcgaccacgtgcgcgactgggtgctgggttccacg
gaatgggtgtcgatgggcgtgccgtcggacggcagctacggcattcccgagggcatcatt
ttcggctatccctgcacgaccgcgaacggccagtacacgatcgtgaagggcatcgagcac
aacgacttcgcgaaggcgaagatcgcggccacgcagaaggagctcgaagaggagcgggct
gcgatcgcgcatctcctcaagtag

DBGET integrated database retrieval system