KEGG   Blochmannia endosymbiont of Polyrhachis (Hedomyrma) turneri 675: BTURN675_274Help
Entry
BTURN675_274      CDS       T03907                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bed  Blochmannia endosymbiont of Polyrhachis (Hedomyrma) turneri 675
Pathway
bed00061  Fatty acid biosynthesis
bed00780  Biotin metabolism
bed01100  Metabolic pathways
bed01212  Fatty acid metabolism
Module
bed_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bed00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BTURN675_274 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BTURN675_274 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bed01004]
    BTURN675_274 (fabZ)
Enzymes [BR:bed01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BTURN675_274 (fabZ)
Lipid biosynthesis proteins [BR:bed01004]
 Fatty acid synthase
  Component type
   BTURN675_274 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT
Motif
Other DBs
NCBI-ProteinID: AKC59855
UniProt: A0A0E3Y805
LinkDB All DBs
Position
complement(322512..322979)
Genome map
AA seq 155 aa AA seqDB search
MTTDNHVLHIEEVLELLPHRFPFLLVDRVLDFQKGKFLRAVKNVSFNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSNGKLSPGELYYFAAIDEARFKRPVHPGDQMILEVEFIKE
RCGVARFKGIVTVDGDTACEASMMCARRKESTMCD
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgataaccatgttctacatattgaagaagtattagaacttttaccccaccga
tttccattcttgttagttgatcgtgtgttagattttcaaaaaggaaaatttttacgagca
gtaaaaaacgtttcgtttaacgaaccatttttccaaggacattttcctggaaaaccaatc
ttccctggcgtattaatattagaagctatggcacaagcaacaggtatattagcgtttaaa
agtaacggtaaattatctccaggagaactatattattttgctgctattgatgaagctaga
tttaaacgtccagtacatcctggggatcaaatgattctcgaagttgaatttattaaagaa
cgatgcggagtagcacgttttaaaggtatagttacagttgatggagacacagcctgtgag
gcatcaatgatgtgcgcacgccgaaaagagagtacaatgtgtgattaa

DBGET integrated database retrieval system