KEGG   Blochmannia endosymbiont of Polyrhachis (Hedomyrma) turneri 675: BTURN675_322Help
Entry
BTURN675_322      CDS       T03907                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bed  Blochmannia endosymbiont of Polyrhachis (Hedomyrma) turneri 675
Pathway
bed00020  Citrate cycle (TCA cycle)
bed00190  Oxidative phosphorylation
bed00650  Butanoate metabolism
bed01100  Metabolic pathways
bed01110  Biosynthesis of secondary metabolites
bed01120  Microbial metabolism in diverse environments
bed01130  Biosynthesis of antibiotics
bed01200  Carbon metabolism
Module
bed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bed_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bed_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTURN675_322 (sdhA)
   00650 Butanoate metabolism
    BTURN675_322 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BTURN675_322 (sdhA)
Enzymes [BR:bed01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BTURN675_322 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BTURN675_322 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-ProteinID: AKC59898
UniProt: A0A0E3Y829
LinkDB All DBs
Position
379667..381442
Genome map
AA seq 591 aa AA seqDB search
MHNIPTKEFFAIVIGSGGAGMRAALEISQHGLSCAVISKVFPIRSHTVSAQGGITVALSN
VHKDDWQWHMYDTVKGSDYLGDQNAIEYMCKEGPNAVLELEHMGMPFSRLHDGRIYQRPF
GGQSINYGTGQAARTAASADRTGHALLHTLYQQNIKNSTTIFSEWYAIDLVKNQDGHVLG
CLCLCIMTGEIVYFKARATILATGGAGRIYQFTTNAHINTGDGIGMALRAGIPVQDMEMW
QFHPTGIAGIGILISEGCRGEGGYLLNKHDERFMERYAPNSQDLASRDIISRSIMTEIYE
GRGCEGIHGCYVKLQLHHLKKETLESRLPGILELTRKFANIDPVKESIPVIPTCHYMMGG
IPTTTNGQVISVNDNGDDILIPGLFAIGEVACVSVHGANRLGGNSLLDLIVFGRSTGLFL
KKLFKEGEYSIRNASRSDIEAALNRYFHWKKTCTTGEKPNEIKKALQSCMQKYFSVFREK
NTMMQGLQELQNIRERLKYASLNDSSNVFNTERIECLELDNLLETAYSTAVSANFRTESR
GAHYRSDFPYRDDNNWLCHTLYFSRTNTVRCRKINMQPVFRSAFPPKTRIY
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgcataatatacctacaaaagaattttttgctattgttattggctctggaggcgctggc
atgcgtgctgcattggaaatttcacaacacggactatcttgcgcggtaatttctaaggtc
tttccaatacgttctcacacagtatcagctcaaggcggaattactgttgcactttctaat
gtgcataaagatgattggcaatggcatatgtatgatacagtaaaagggtcagattatctt
ggtgatcaaaatgcaattgaatatatgtgtaaagaaggacctaatgcggtattagaacta
gaacatatgggaatgccattttcccgtttacatgacggacgtatttatcaacggccattc
gggggtcaatctataaattatggaacaggacaagcagcacgaactgccgcttcggctgat
cggacaggacatgccttgctgcatactttatatcaacaaaatataaaaaatagcacaact
attttttcagaatggtatgcaattgatttagtaaaaaatcaagatggccatgtacttggt
tgcctttgtttatgtattatgaccggggagatagtctattttaaagctcgtgccacaata
cttgcgacaggaggagcaggtagaatttatcaattcactacaaatgcacatattaatacc
ggagatggaattggaatggcattacgggctggtatacctgtgcaagatatggaaatgtgg
caatttcatccaactggtatagctggaattggaattttaattagtgaaggttgtcggggc
gaaggcggatatcttttaaataaacatgatgaacgttttatggaacgatatgctcctaac
tctcaagacttagcgagccgggatattatttctcgatctattatgacagaaatatatgaa
ggacgaggatgtgaaggtatacatggatgttatgtaaaattacaattacatcacttaaaa
aaagaaactctagaatcgcgtttacctggaattttagaattaacgcgtaaatttgctaat
attgacccagtcaaagaatcgattccagtaatacctacttgccattatatgatgggcggt
attcccacaacaacaaacggacaagtcattagtgtcaatgacaacggtgatgatatttta
attcctggtttgtttgcgataggtgaagttgcatgtgtatcagtccacggagcaaacagg
ttgggaggaaattcacttttagacttaatagtatttggacgttctacaggattgttttta
aaaaaattatttaaagaaggggaatactcaataagaaatgcgagtcgttcagatattgaa
gcagcactcaatcgctattttcattggaaaaagacttgtacaacaggggaaaaacctaat
gaaataaaaaaagcgttacagtcttgtatgcaaaaatatttttctgtgtttcgtgaaaaa
aacacaatgatgcaaggattacaagagctacaaaacattcgtgaacgattaaaatacgca
tctttaaatgattcatctaacgtgtttaatacagaaagaattgaatgtttagaattagat
aatttgttagaaactgcttattctacagctgtgtctgctaattttcgaactgaaagtcga
ggcgcacattatcgttctgattttccataccgtgatgacaataattggttatgtcataca
ttatatttttctcgcacaaacactgtgcgttgcagaaaaattaatatgcaacctgttttt
cgttcagcatttccaccaaaaacacgaatttattga

DBGET integrated database retrieval system