KEGG   Blochmannia endosymbiont of Polyrhachis (Hedomyrma) turneri 675: BTURN675_323Help
Entry
BTURN675_323      CDS       T03907                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bed  Blochmannia endosymbiont of Polyrhachis (Hedomyrma) turneri 675
Pathway
bed00020  Citrate cycle (TCA cycle)
bed00190  Oxidative phosphorylation
bed00650  Butanoate metabolism
bed01100  Metabolic pathways
bed01110  Biosynthesis of secondary metabolites
bed01120  Microbial metabolism in diverse environments
bed01130  Biosynthesis of antibiotics
bed01200  Carbon metabolism
Module
bed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bed_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bed_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTURN675_323 (sdhB)
   00650 Butanoate metabolism
    BTURN675_323 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BTURN675_323 (sdhB)
Enzymes [BR:bed01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BTURN675_323 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BTURN675_323 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AKC59899
UniProt: A0A0E3Y6G9
LinkDB All DBs
Position
381470..382204
Genome map
AA seq 244 aa AA seqDB search
MRKITLSIYRYNPEINDQPYMQNYFFEFSKSSNMMLLDVLIELKNQDPTLSFRRSCREGV
CGSDSMNINGKNGMACVTPLLTLCKNTNIIFVRPLPGLPVIRDLVVDMSPFYAQYEKIKP
FLINNDKIKNTSHEYLQSPYERSKLDGLYECILCGCCSTFCPSFWWHPNKFIGPAGLLTA
YRFLVDTRDTNSQERLKDLNDTFSVFRCHNIMNCVHVCPKGLNPNIAINKIKRMLLKYNF
MNKN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaattacactatctatatatcgttataatcctgaaatcaatgatcaaccatac
atgcaaaattatttttttgaatttagtaaatcatccaatatgatgttattagatgtatta
attgagttaaaaaatcaggatcctacgttgagttttcgtcgttcttgtagagaaggggta
tgtggttctgatagtatgaatattaatgggaaaaatggcatggcttgtgttactccattg
ttaacattatgtaaaaatactaatatcatttttgttcgtccattacctggacttccggta
attcgtgatttagtggtagatatgagtccattttatgcacaatatgaaaaaattaaacca
tttttaattaacaatgataagataaaaaacacatcacatgaatatttacaatcaccatat
gaacgttctaaattagatggactatatgaatgtatattatgcggttgctgttctactttt
tgtccttccttttggtggcatccaaataaatttattggtccagctggattattgactgca
tatcgatttttagttgatactcgtgatacaaattctcaagaacgtcttaaagatcttaat
gatacttttagtgtattccgttgtcataatattatgaattgcgtccacgtgtgtcctaaa
ggtttaaacccgaatatagctattaataaaatcaaacgtatgttattaaaatataatttt
atgaataaaaattaa

DBGET integrated database retrieval system