KEGG   Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757: BOBLI757_136Help
Entry
BOBLI757_136      CDS       T03906                                 

Gene name
ftsI
Definition
(GenBank) peptidoglycan synthase ftsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
ben  Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757
Pathway
ben00550  Peptidoglycan biosynthesis
ben01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ben00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BOBLI757_136 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BOBLI757_136 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ben01011]
    BOBLI757_136 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ben03036]
    BOBLI757_136 (ftsI)
Enzymes [BR:ben01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BOBLI757_136 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:ben01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BOBLI757_136 (ftsI)
Chromosome and associated proteins [BR:ben03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BOBLI757_136 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AKC60311
UniProt: A0A0E3U4G5
LinkDB All DBs
Position
166316..168013
Genome map
AA seq 565 aa AA seqDB search
MKGKMFRYVKKNIVRRMFFIYVFIFFSMCILVLRTAYLQLIIPNELVREGDLRSLRMQRI
SMTRGMVVDREGRPLAVSVPVYAIWADPKEIGRHNIVINNDERWKALSEVLSLSLDQLLI
RIHSNIKGRFVYLARQVDPSISEYILKLRLPGIYLRQESRRYYPSGCVSAHIVGITDIDG
RGIEGIEKSFDAYLTGYPGARIIRKDRFGRVIENVLSIDSQDSRNIVLSIDERLQTLVYR
ELNNAVINNKAQSGSAILVDINTGEILAMVNIPSYNPNSLSTAALSSMRNSAITDLFEPG
STIKPIVIISALEHGVINENSIINTEPYVINGHMIKDVVHYNKLTVAEVLQKSSNVGVSR
IALSMPSNVLMNAYSKFGIGKSTNLGLVGESNGIYPSDQRWSSVERAIFSYGYGFMVTPL
QLVRVYATIGSMGVFRPLSILKVDEPVIGERLFPSSIVRSVIYMMENIALPGGTGAKAAV
KGYRIAIKTGTAKKVGYNGKYINKYIAYTAGVAPASHPRFALVVIVNEPHNNKYYGGLVS
APVFSAIMSSVLRMMNVEPDGLSIY
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaagatgtttagatatgtaaaaaaaaatatagttcgtcgtatgttttttata
tatgtttttatttttttttcaatgtgtattttggtattaagaacagcttatttacaatta
attattcctaatgaattagtacgagaaggtgatttacgttccttgcgtatgcaaagaatt
tctatgactcgcggcatggtagtcgatcgtgaaggacgtccattagcagtaagcgttcca
gtttatgcaatttgggctgatcctaaagagattggccgacataatattgttattaacaat
gatgagcgttggaaggctttatccgaagtattatctttatctttagatcaattgttgatt
cgtattcattcgaatataaaaggacgttttgtttatttagctcgtcaagtggatccatct
attagtgaatatatacttaagcttcgattacctggcatttatttacgtcaagaatctagg
cgttactatccttctggatgtgtttcagctcatatagttggtataactgatatagatggt
cgaggtattgagggtattgaaaaaagttttgatgcttatcttacaggatatcctggtgca
agaatcatccgtaaagatcgttttggtagggttattgaaaatgttttgtctatagatagt
caggattcgcggaatatagtgctaagcatagatgaacgcttacagaccttggtttatcgt
gagttaaataatgcagtgattaataataaagcgcaatctggttctgcaattttagtagat
atcaataccggtgaaatattagcaatggttaatattccgtcttataatcctaatagttta
tctactgctgcattatcttcaatgcgtaatagtgcaattactgatctttttgaacctgga
tctactataaaaccaatagttataatatctgctttagaacatggtgtgataaatgaaaat
agtataataaatacagaaccttatgtaatcaatgggcatatgattaaagatgtggtgcat
tataataaattaaccgtagcagaggtattacaaaaatcaagtaatgttggggtatctagg
atagccttgtcaatgccatcaaatgtattgatgaatgcttattcaaagtttggtatcggt
aaatctactaatttaggtttagttggagagagtaatggtatatatccaagtgatcaacga
tggtccagtgtcgagcgagctattttttcttatgggtatggatttatggttacgccatta
caattagttagagtatatgcaactattggtagtatgggtgtttttcgtccactttctatt
ttaaaagtggacgaacctgttattggtgagcgattatttccctcgtctatagtgcgcagt
gttatatatatgatggaaaatatagcattgcctggtggtactggtgctaaagctgccgtt
aaaggatatcgtattgctattaaaacaggtactgctaaaaaagttggttataatggtaag
tatattaataagtatattgcatataccgctggtgttgctccagccagtcatccacgattt
gctttagtagtaattgttaatgaaccgcataataataaatattatggagggttagtatca
gcgccagtgtttagtgctattatgagtagtgttttacgtatgatgaatgttgaaccggat
ggtcttagtatatattaa

DBGET integrated database retrieval system