KEGG   Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757: BOBLI757_154Help
Entry
BOBLI757_154      CDS       T03906                                 

Gene name
mrcB
Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ben  Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757
Pathway
ben00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ben00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BOBLI757_154 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ben01003]
    BOBLI757_154 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ben01011]
    BOBLI757_154 (mrcB)
Enzymes [BR:ben01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BOBLI757_154 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BOBLI757_154 (mrcB)
Glycosyltransferases [BR:ben01003]
 Polysaccharide
  Bacterial polysaccharide
   BOBLI757_154 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:ben01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BOBLI757_154 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter DUF3963
Motif
Other DBs
NCBI-ProteinID: AKC60329
UniProt: A0A0E3Y7X4
LinkDB All DBs
Position
196013..198373
Genome map
AA seq 786 aa AA seqDB search
MGAVGYYKYFTLLFLKKLLRDITFCFIPFVFIVVILYGVYLDVQIRSRIDGKIWKLPTVV
YSRIVVLEPGMLYSCRDIVTLLKSMHYRQVPVITSPGEFVVKSNVIELLRRSFNFPDGEE
EQVYVCITFSVDRLLQITNKDTQRNFSVFRLDPKLITILEETSLGVQRLFIPRSNFPDLL
VNMLIVTEDRQFYQHDGISLYSIGRAALANLLAGRTIQGGSTLTQQLVKNLFLSNNRSVW
RKINEVYMALILDYRCSKDRILELYLNEVYFGQNGNDQIRGFPLASLYYFGRPVNELSVD
QQAMLVGIVKGASLYNPWRNPKLVLERRNIILKLLEVEHIIDDVTCVMLSKLPLGIQSKG
DIFTPQPAFIQMIREELYNKCGHQINNCFGKKIFTTLDPVSQHAAEQAIELGISMLRTRR
NINDLEGAIVVVDRFSGEIRAMVGGADPQFAGFNRAMQARRSIGSLVKPVTYLAALNDPK
KYRLNTWIADEPIKVKLDNGSIWVPKNYDRQFRGKVMLIDALAKSLNVPSVNLGLSVGLE
NVINILKKLGIPPSALTSLPSIFLGALNLTPVEVAQGFQTIASGGNYSVLSSVRSIVNDN
NTILYQSFPQSMHVISSEAAYLILYAMQQVVSYGTSCSLCKNFSLFNLAAKTGTTNDLRD
SWFVGIDGREVVVIWLGRDNNGTIKLTGANGALSIYHLYLKYQPPITLNLIPPDGIIQMF
IDCEGNFIDNNEKAFCVLPVWTDSPQLLLNQESQVVNYDQLQQRNFICNQKNESKIINWI
QELFDK
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgggggctgttggatattataaatattttactttattgtttttaaaaaaattattacgt
gatataactttttgttttatcccatttgtttttattgtagtaattctttatggtgtatat
ttagatgtacagatacgtagccgaattgatggtaaaatatggaaattaccaactgtagtt
tatagtcgtatagtagttttagaaccagggatgttatatagttgtagagacattgttact
ttattaaaaagcatgcattatcgtcaagtgcctgtaattacgtctcctggtgaatttgtt
gtaaaatctaatgtaattgaattattacgcagatcttttaattttccagatggagaagaa
gagcaagtttatgtttgtataactttttctgtagatagattattacaaattacaaataaa
gatacccaacgtaattttagtgttttccgtcttgatcctaaattaattactatattagaa
gaaacatcacttggagtacaaagattatttatacctagatcgaattttccagatttatta
gtaaatatgttaattgttactgaagatagacagttttatcagcatgatggcattagttta
tattctattgggcgagccgcattagctaatttattagctggacgtacaatacagggtggt
agtactttgacacaacaattagtaaaaaatttgtttttatctaataatcgatctgtttgg
cgtaaaataaacgaagtatatatggcacttattttggattataggtgtagtaaagatcgt
atacttgaattatatttaaatgaggtatattttgggcaaaatggtaatgatcagattcgt
ggttttccgttagccagtttgtattattttggaagaccagtaaatgagttaagtgtagat
caacaagctatgttagtaggtattgttaaaggcgcttcattatacaatccttggcgtaat
cctaagttagtattagaacgtcgtaatataatattaaaactattagaagtagagcatatt
atagatgacgtaacctgtgttatgttaagtaaattgccattaggtattcaatctaagggt
gatattttcacgcctcaaccagcgtttatacaaatgatacgtgaagaattgtataataaa
tgtggtcatcaaattaataattgttttggaaaaaaaatattcaccactttagatcctgtg
tctcaacatgcggcagagcaagcaatagagttgggtatttcaatgttacgcactcgtcga
aatattaatgatttagaaggagcaatagtagtggtggatcggtttagtggtgaaatacgt
gctatggtaggtggagcagacccacaatttgctggttttaatcgtgccatgcaagctaga
cgttctataggttctttagttaaaccagttacttatcttgcagcattaaatgatcctaaa
aagtatcgattaaatacatggattgcagatgagcctattaaggttaaattagataatggt
agtatttgggttccaaaaaattatgatagacaatttcgtggtaaagttatgttaattgat
gcgttagctaaatctttgaatgttccatctgtaaatcttggcttatcggtaggattagaa
aatgttataaatattttaaaaaaattaggtattcctccatccgcattaacttctttacca
tctatatttttaggtgctttaaatttaactccagtagaagtggcacaagggtttcaaact
atagctagtggtggtaattattctgttttatcttcggtacgttcaattgttaatgataat
aatactattttatatcaaagttttccacaatctatgcacgtaatatcatctgaggcagca
tatttgatattatatgcaatgcagcaggtagtatcatatggtacatcttgttctctttgt
aaaaatttttctttatttaatttggctgctaaaacgggcactactaatgatttacgtgat
agttggtttgttggtattgatggcagggaagttgttgtaatttggcttggtcgtgataat
aatggtacaattaaattaactggtgctaatggtgctttgagcatttatcatctttattta
aaatatcaaccgccaattacgttaaatttaataccgccggatggtattattcagatgttt
attgattgtgagggaaattttatagataataatgaaaaagctttttgtgttttgccagtt
tggactgatagtcctcaattgttgttgaatcaggaatcgcaggttgttaattacgatcaa
ttacaacaaagaaattttatttgtaatcaaaaaaatgagagtaaaattataaattggatt
caagaattatttgataaatga

DBGET integrated database retrieval system