KEGG   Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757: BOBLI757_178Help
Entry
BOBLI757_178      CDS       T03906                                 

Gene name
aroF
Definition
(GenBank) Phospho-2-dehydro-3-deoxyheptonate aldolase, Tyr-sensitive
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ben  Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757
Pathway
ben00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ben01100  Metabolic pathways
ben01110  Biosynthesis of secondary metabolites
ben01130  Biosynthesis of antibiotics
ben01230  Biosynthesis of amino acids
ben02024  Quorum sensing
Module
ben_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ben00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BOBLI757_178 (aroF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BOBLI757_178 (aroF)
Enzymes [BR:ben01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     BOBLI757_178 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AKC60351
UniProt: A0A0E3U4I2
LinkDB All DBs
Position
224829..225914
Genome map
AA seq 361 aa AA seqDB search
MQEKTDKNINFYNNQEMITPAELKSRFPLKEKESRFVCDSQQIIANIIHGKDSRLLIVCG
PCSIHDVDSTIDYAHRLKVLSDELSDKLYIVMRVYLEKPRTVLGWKGLINDPHMDGSFDI
KSGLEISRSLLLKLLTMGLPLANEALDLNTPQYLGELFSWSAIGARTTESQVHRELASAL
PMSIGFKNSTSGNLMSAINAIRAASISHCFMGINQSGRICLLKTQGNLNGHVILRGGIKP
NYYPEDIAYCESQLLKVGLPLFLMVDCSHGNSNKNYHDQIKVARSILDQIKDGNRSIVGL
MLESHIYSGNQVLQLPYVKLRYGVSVTDACIDWISTENLLRQLHMELNSILSNRLVGAMN
T
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaaacggataaaaatattaatttttataataatcaagaaatgattactcca
gcagaattaaaaagccgatttcctttaaaagaaaaggagagtcgttttgtttgtgattcc
caacagattattgccaatattattcatggtaaagattcgagattattgatagtgtgcggc
ccttgttccattcatgatgttgattctactatagattatgcacatcgtttaaaggttctt
tctgatgaattaagtgataaattatatattgtcatgcgtgtttatcttgaaaaacctcgt
actgttttaggttggaaaggtttaattaatgatccccatatggatggatcttttgatatt
aaaagtggattagaaatttccagatctttattattgaaattattaacaatgggattacca
ttggccaatgaagctttagatttaaatacaccacagtatcttggagaattatttagttgg
tctgctattggcgctcgtactactgaatctcaagttcatcgtgaattggcatctgctttg
cctatgtctataggttttaaaaatagtactagtggaaatttaatgagtgcaattaatgct
atacgagcagcatcaatatctcattgttttatgggtattaatcagagtggaagaatttgt
ttattaaaaacgcaggggaatttaaatggacatgttattttacgtggaggtataaaaccg
aattattatccagaagatattgcatattgtgaaagtcaattgttaaaagttgggttacca
ttatttttaatggttgattgtagtcatggaaattctaataaaaactatcatgaccaaatc
aaagtagcaagatctattttagatcaaattaaagatggtaatcgttctattgtgggattg
atgttagaaagtcatatttattctggtaatcaggttttacaattaccttacgttaagtta
cgttatggtgtatcagttactgatgcttgtattgattggattagtactgaaaatttattg
cgtcagttgcatatggaattaaattctattctttctaatcgtttagtaggagctatgaat
acatga

DBGET integrated database retrieval system