KEGG   Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757: BOBLI757_284Help
Entry
BOBLI757_284      CDS       T03906                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ben  Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757
Pathway
ben00061  Fatty acid biosynthesis
ben00780  Biotin metabolism
ben01100  Metabolic pathways
ben01212  Fatty acid metabolism
Module
ben_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ben00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BOBLI757_284 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BOBLI757_284 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ben01004]
    BOBLI757_284 (fabZ)
Enzymes [BR:ben01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BOBLI757_284 (fabZ)
Lipid biosynthesis proteins [BR:ben01004]
 Fatty acid synthase
  Component type
   BOBLI757_284 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT
Motif
Other DBs
NCBI-ProteinID: AKC60448
UniProt: A0A0E3Y928
LinkDB All DBs
Position
332503..332958
Genome map
AA seq 151 aa AA seqDB search
MTVDSDILHIEEVLDLLPHRFPFLLIDRVLNFEQGKFLKAVKNVTFNEPFFQGHFPGRPI
FPGVLILEAMAQATGILAFKSFGKLKSGELYYFAAIDEARFKRPVEPGDQMIIEVKFIKE
RRGIARFKGVVQVSNEMVCEALMMCARRRET
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgacagttgattccgatattttgcatattgaagaagtattagatcttttaccccatcga
tttccatttttattaatcgatcgtgtgttaaattttgaacaaggaaaatttttaaaagca
gtgaaaaatgttacttttaatgaaccattttttcaaggacattttccaggtaggcctatt
tttccgggtgtattaattttagaagctatggctcaagcgacaggtattttagcatttaaa
agttttggtaaactgaagtcgggtgaactgtattattttgctgctatagatgaagctaga
tttaaacgtccagttgaacctggagatcaaatgataattgaagttaaatttattaaagaa
cgtcgtggtattgcacgttttaagggtgttgtgcaagttagtaatgaaatggtttgtgaa
gcattaatgatgtgtgcacgtcgtagagagacttaa

DBGET integrated database retrieval system