KEGG   Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757: BOBLI757_422Help
Entry
BOBLI757_422      CDS       T03906                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ben  Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757
Pathway
ben00061  Fatty acid biosynthesis
ben00780  Biotin metabolism
ben01100  Metabolic pathways
ben01130  Biosynthesis of antibiotics
ben01212  Fatty acid metabolism
Module
ben_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ben00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BOBLI757_422 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BOBLI757_422 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BOBLI757_422 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ben01004]
    BOBLI757_422 (fabI)
Enzymes [BR:ben01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BOBLI757_422 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BOBLI757_422 (fabI)
Lipid biosynthesis proteins [BR:ben01004]
 Fatty acid synthase
  Component type
   BOBLI757_422 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AKC60574
UniProt: A0A0E3Y7N9
LinkDB All DBs
Position
491900..492682
Genome map
AA seq 260 aa AA seqDB search
MGFLNGKRILVTGIANTRSIAYGIAQVLHREGAELAFTYPNNKLKLRIKKYSNNFNSNII
CPCNVSNDDSITQLFIELKKYWSTFDGFIHAIAFAPSNQLNGDYVSVINRESFIIAHDIS
CYSFVALAKACRNMLNVHASLVTLTYLGAQRAIPNYNVMGLAKASLEANTKYMANSMGPD
GIRVNAISPGPIRTLASSGIANFKKMLSYYESYAPMRKNVTIEDIGNTAAFLCSNLSAAI
TGEVIYVDGGFNITHTNKLE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcttaacgggaagcgtattctagttactggtatagctaatactcgctcaata
gcatatggcattgctcaagtattacatcgagaaggggcagaattagcatttacttatccg
aataataaactgaaactacgcataaaaaaatactcaaataattttaattctaatattatt
tgcccgtgcaatgtttcaaatgatgatagtattactcaactttttatagaactaaaaaaa
tattggtctacttttgatggttttatacatgccattgcttttgcaccttcaaaccaatta
aacggtgattatgtaagtgttataaatcgtgaaagttttattatagcacatgacataagt
tgttacagttttgttgcattagctaaagcatgcagaaatatgcttaatgtacatgcatcc
ttagtaacattaacttatctaggtgctcaacgtgctattcctaattataatgttatggga
ttagctaaagcttctttagaagcaaataccaaatatatggcaaattctatgggtcctgac
ggcattagagttaacgccatttctcctggccctatacgtacgttagcttcgtctggcata
gcaaattttaaaaaaatgttatcttattatgaatcttatgctccaatgagaaaaaatgtc
accattgaagacattggaaatacggcagcttttttatgttctaatctatctgcggctatt
actggtgaagtcatttatgtagatggtggatttaatatcacacatactaataaactagaa
taa

DBGET integrated database retrieval system