KEGG   Bacillus endophyticus: BEH_00910Help
Entry
BEH_00910         CDS       T03983                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
beo  Bacillus endophyticus
Pathway
beo00040  Pentose and glucuronate interconversions
beo00051  Fructose and mannose metabolism
beo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BEH_00910
   00051 Fructose and mannose metabolism
    BEH_00910
Enzymes [BR:beo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BEH_00910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C AdoHcyase_NAD 2-Hacid_dh_C Hexapep
Motif
Other DBs
NCBI-ProteinID: AKO90836
UniProt: A0A1X7GBG2
LinkDB All DBs
Position
165207..166268
Genome map
AA seq 353 aa AA seqDB search
MTNNVPTTMKAAVMHSIRDIRIETLPVPQLKDDEVLVKVMAVGICGSDLHYYTDGRIGHY
KVEKPIILGHECAGEVAAIGANVNRVKVGDRVAVEPGVTCGTCEACKEGRYNLCPDVEFL
ATPPVDGAFVQYIKMRQDFVFQIPDTLSYEEAALIEPFSVGIHAAARTKLQAGEIVAIMG
MGPVGLMAVAAAKAVGASQIIVTDLEPLRLEAAKEMGATHTINVAEQDPMDEISKITRGK
GVDVAWETAGNPAALQSALSSLRRGGRLAIVGLPAQNEIPLNIPFIADNEVDIYGIFRYA
NTYPKGINFLSSGVVDAKKLVTDRYRLEDTMEAMERALNHKNECLKIVVYPNQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactaacaatgtacctacaacaatgaaagcagcggttatgcatagtataagagatatt
cggattgaaactttaccagtgccacaactaaaggatgatgaggttttagttaaagtaatg
gctgttggaatttgtggttctgatttacattactatacagatggacgaattggtcactat
aaagtagaaaaaccaattattcttggccatgaatgcgcaggagaagtggccgctattgga
gctaatgttaatagggtgaaagttggggatcgtgttgcagttgaacctggtgttacttgc
gggacatgtgaagcctgtaaggaaggaagatataatctttgtccagatgtagagttttta
gcaactcctcctgttgatggggcatttgttcaatatataaaaatgagacaggactttgtt
tttcaaattccagataccctttcatatgaagaagcagctttaattgaacctttttcagta
ggaattcatgcagcagcaagaacaaagcttcaagcaggcgagatagtagctattatggga
atgggaccagttggtttgatggctgttgcggcagctaaagcagttggggcaagtcaaatt
atcgtaacagacttagaaccattacgacttgaagcggcaaaagaaatgggagcaacacat
acaattaatgttgcagaacaagaccctatggatgagattagcaagattacacgtggcaag
ggcgtagacgttgcgtgggaaacagcgggaaacccagctgctcttcaatctgctctttct
tccttacgacgtggtggaagacttgcaattgtagggctgcctgctcaaaatgaaattcct
cttaatattccatttattgcagataacgaagttgatatttatggtatctttcgttatgcc
aacacatatccaaaaggaattaattttctctcttcaggggtagttgatgctaaaaaatta
gttactgatcgatatagactagaggatacgatggaagctatggaacgagcactcaaccat
aaaaatgaatgtttaaaaattgttgtgtatccaaatcaataa

DBGET integrated database retrieval system