KEGG   Bacillus endophyticus: BEH_01405Help
Entry
BEH_01405         CDS       T03983                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
beo  Bacillus endophyticus
Pathway
beo00473  D-Alanine metabolism
beo01100  Metabolic pathways
beo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BEH_01405
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BEH_01405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:beo01011]
    BEH_01405
Enzymes [BR:beo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BEH_01405
Peptidoglycan biosynthesis and degradation proteins [BR:beo01011]
 Precursor biosynthesis
  Racemase
   BEH_01405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKO90912
UniProt: A0A1X7GF68
LinkDB All DBs
Position
273582..274739
Genome map
AA seq 385 aa AA seqDB search
MNSFYRNTWAEIDLEAVSHNVNCLKEWLPKGKQIMAVVKANGYGHGDIEVAKEAIGAGAT
FLGVALLDEGIKLRANGIKVPILVLGDVPPSYVDIAAEYDISLTLHNESWLREASKYDIK
KPLSLHMKIDTGMNRIGFKDKDVMERVVSKVKQSSHFVLEGLFTHFATADELHSEYYEEQ
SKCFVETVYYLKSKGICPPNVHCANSASTLRLPHDCFTMVRFGISMYGLSPSSEMKKVLP
FTLKPVLSLYTSLIHVKSLEEGESISYGATYTTKKEEWIGTVPIGYADGWLRGLQGFTAL
MNGEEVQNVGRICMDQLMFRLPKDAAVGTKVTLIGHDGGKSISADDIASYLNTINYEVTC
MISDRVPRVYKRADKVVKVINNVLA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcgttttaccgtaacacatgggctgaaattgatttagaagctgtttctcataac
gtaaattgcttaaaagaatggctgccaaagggtaaacaaattatggctgttgtaaaagca
aacggatatgggcacggtgatattgaagtagcgaaagaagcaattggagcaggagctacg
tttttaggagtagcattgcttgatgagggaattaaactaagagcaaatgggattaaagtt
ccgattttagtattaggagacgtgcctccttcatatgttgatattgcagcagagtatgat
atctcacttacccttcataatgaaagttggttacgtgaagcatcaaagtatgatataaag
aagcctctttctcttcatatgaaaattgatacaggcatgaatcgcattggatttaaagat
aaagatgtaatggagcgtgttgtctcaaaagttaaacaatcttctcattttgtgctagag
ggcctttttacacattttgcaacagcagatgagcttcatagtgagtattacgaagagcaa
agtaagtgtttcgttgaaactgtgtattatctgaaatcaaaagggatttgtcctcctaac
gttcactgtgcaaacagtgcttcaactttacgtttaccacatgattgttttacaatggta
cgcttcgggatttcaatgtacggtttaagcccgtcatctgaaatgaaaaaagtattgcca
tttacattaaagccagttctatctctctatacatctttgatacacgttaagagtctagaa
gagggtgaaagcattagctatggagcaacatacacaacaaagaaagaagaatggatcgga
actgtgccaattggttatgcagacggttggcttcgaggtcttcaaggttttacagcatta
atgaacggagaggaagtacaaaatgttggacgcatttgcatggatcaacttatgtttaga
cttccaaaagatgcagcggtcggcacaaaagtcacgttaataggtcatgatggcgggaag
tccattagcgcagatgatattgcaagctatcttaatacaattaattatgaagttacttgt
atgattagtgatcgcgttcctcgagtatataagagagcagataaagttgtaaaagttata
aataatgtgctagcttaa

DBGET integrated database retrieval system