KEGG   Bacillus filamentosus: BEH_16285Help
Entry
BEH_16285         CDS       T03983                                 

Definition
(GenBank) nitrite reductase large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
beo  Bacillus filamentosus
Pathway
beo00910  Nitrogen metabolism
beo01100  Metabolic pathways
beo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BEH_16285
Enzymes [BR:beo01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     BEH_16285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Rubredoxin_C Pyr_redox NIR_SIR_ferr Pyr_redox_3 NAD_binding_9 AlaDh_PNT_C GIDA NAD_binding_7 3HCDH_N CheB_methylest
Motif
Other DBs
NCBI-ProteinID: AKO93495
UniProt: A0A1X7DFB6
LinkDB All DBs
Position
complement(3316081..3318492)
Genome map
AA seq 803 aa AA seqDB search
MEKQKLVVIGNGMAGVRAVEEILKLDPNRFSITIFGSEPHPNYNRIMLSKVLQGDTEISD
IVLNSLEWYEENNITLHKGEEVIKIDRESKTLFTNKGREESYDKLIIATGSNPLMIPFKG
IDKEGVVTFRDIADCEKMVDASKQYKKAAVIGGGLLGLEAARGLLNLGMEVDVIQNMPYV
MNRQLDETAGNLLQKSLGDQGMNILVNHDTDEFLGEERVTGIRFKDGSEIKADLIVMAIG
IVPNTSLAKESGLTVNRGIAVDDHLQTSDPDIFSVGECAEHRGIAYGLVAPLYEQGKVLA
HRILEQECAPYEGSVLSTQLKVSGVDVFSAGEFMEHEVENAYAIKIFDEVSNVYKKLLIK
DEKLIGAVLFGDTKDGNKLFQMIQKGSTLEGLSPTLFSTNSGKEESLVASMSDDDIICGC
NGVSKGTICSAISEGGLTSVDEVKDATTACRSCGGCKPLVAELISLTAGSEVEQKEAICS
CTTLSRDEVVAEIKEKGLTHSKEVMNVLGWKNDEGCSKCRPALNYYLGMIDPEQYEDERE
SRFVNERMHANIQKDGTFSVVPRMYGGVTNPKELRKIADVADKYNIPLVKVTGGQRLDLL
GAKKEDLPKIWEELDMPSGYAYGKTLRTVKTCVGESFCRFGTQDSMGLGIKLEKKFERLQ
TPHKVKMSVSACPRNCAESGIKDVGIVGIEGAFEIYVGGNGGTHLRAGDLLCKVATEEEV
MEMSSAFLQYYRENANYLERTSAFVERVGLAHIKEVLDNIDTRTELNIRMDKALAVTTDP
WREIIESKNTKNELFTNVMLQKG
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaagcaaaaacttgttgtaattggaaatggaatggctggtgttcgagctgtagaa
gagattttaaaattagaccctaatcgcttttcgattacgatttttgggagtgagccacat
ccaaactataacagaattatgttatcaaaagttcttcaaggggatacggagatttcagat
attgtgttaaatagtctagagtggtatgaggaaaataacattactcttcataaaggcgaa
gaagtaatcaaaattgatcgtgaatctaaaacgttattcactaataaagggcgcgaagaa
agctacgataaattaatcattgctacaggttcaaacccgcttatgattccattcaaagga
atagacaaagaaggcgttgttacatttagagatatagcagactgcgaaaaaatggtggat
gcatcaaaacagtacaagaaagcagctgttattggaggtggacttctagggcttgaagcg
gcgagaggattgctcaatctagggatggaagtcgatgttattcaaaatatgccgtacgtt
atgaatagacagcttgatgaaacagctggaaatttgcttcaaaagtcgctcggagaccag
ggaatgaatattcttgttaatcatgatacagacgagtttttaggcgaagagagggtaacg
ggaattcgctttaaagacggttcagaaataaaggcggatttgattgtaatggcgattgga
attgttccaaatacctctcttgcaaaagaaagtggtttgacggttaatcgaggaattgcc
gttgatgaccacctacaaacgagcgacccggacattttctcagttggagagtgtgctgaa
catagaggaattgcttacggacttgttgcaccgctttatgagcaaggaaaagtattggca
catcgcattcttgaacaggagtgtgctccatatgaaggttctgttttgtccacacagctt
aaagtgtcaggtgttgacgtattttcagctggagagtttatggaacatgaagtggaaaat
gcctatgccattaaaatatttgatgaagtatcgaatgtttacaaaaagcttcttataaaa
gatgagaaattaattggagctgttctttttggtgatacaaaggatggaaataaacttttc
caaatgattcaaaaaggaagcactcttgagggattgagtccaactcttttctcaacaaat
agtggaaaagaagaaagtcttgttgcctcgatgagtgatgatgacattatctgtggctgt
aatggagtttcgaaaggcaccatttgtagcgcgatttcagaaggcggattaacgagcgtt
gatgaagtcaaagatgccacaacagcgtgtcgctcgtgtggaggctgtaaaccacttgta
gctgaactgattagtttaacagccggaagtgaagtagaacaaaaagaagcgatttgttca
tgtacgactctttctcgcgatgaagttgtagcagagattaaagaaaaaggattaacacac
agcaaagaagtaatgaatgttttaggatggaaaaatgatgaaggatgttcaaagtgtcgt
ccagcacttaattactatcttggcatgatcgatccagagcagtatgaagatgaacgcgag
tctcggtttgtaaatgagcgaatgcatgccaatattcaaaaagatggaacattttccgtt
gtaccgagaatgtacggtggtgttacaaatccaaaagagcttcgcaaaattgctgatgtt
gcagataaatataatattcctcttgttaaagtaacaggtggacagcgattagatctcctt
ggagcaaagaaagaagatttaccgaagatctgggaagagcttgatatgccgtcaggatac
gcgtatggaaaaacgcttcgcactgttaaaacgtgtgtaggagagtcattttgtcgcttt
ggtactcaagactctatggggcttggcattaagctagagaagaaatttgaacgtcttcaa
accccacacaaagtaaaaatgagcgtttcagcttgtccgcgtaactgtgcagagtcaggg
attaaagatgttgggattgtaggaattgaaggagcttttgaaatttatgttggtggaaac
ggaggaacccacttaagagcaggagatttactttgcaaagtagcgacagaagaagaagtg
atggaaatgtcatcagcctttttacaatattaccgcgaaaatgcaaattacttagagaga
acctcagcttttgttgagcgcgttggtcttgctcatattaaagaagtgcttgataacata
gatacaagaacagagcttaacattcgaatggataaagccttagctgtcacaacagatcct
tggcgtgaaattattgaaagtaaaaatacgaaaaatgaactctttacaaatgtaatgctt
caaaaaggctaa

DBGET integrated database retrieval system