KEGG   Bacillus endophyticus: BEH_21150Help
Entry
BEH_21150         CDS       T03983                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
beo  Bacillus endophyticus
Pathway
beo00020  Citrate cycle (TCA cycle)
beo00480  Glutathione metabolism
beo01100  Metabolic pathways
beo01110  Biosynthesis of secondary metabolites
beo01120  Microbial metabolism in diverse environments
beo01130  Biosynthesis of antibiotics
beo01200  Carbon metabolism
beo01210  2-Oxocarboxylic acid metabolism
beo01230  Biosynthesis of amino acids
Module
beo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
beo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BEH_21150
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BEH_21150
Enzymes [BR:beo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BEH_21150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKO94384
UniProt: A0A1X7CRN4
LinkDB All DBs
Position
complement(4281729..4283015)
Genome map
AA seq 428 aa AA seqDB search
MTQGEKIQVNNGVLQVPNKPIIPYIEGDGIGPDIWAAASRVLEAAVQKAYNGERGIVWKE
VLAGEKAYNATGEWLPAETLDAVREYMIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYEKGSEEVKKLIDFLQNEMGVNKIR
FPETSGIGIKPVSEEGTKRLVRGAINYAISEGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EQEFGDKVFTWAQYDRLVETEGKEAANKAQDEAVEAGKIIVKDSIADIFLQQILTRPSEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLMLEHLGWKEAADLVMSAMDKTIASKVVTYDFARLMDGATEVKCSEFGDKLIQ
NMEEEVTV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaggagaaaaaattcaagttaacaacggagtattacaagtacctaataaacca
atcattccatatatcgaaggagacggaatcggtcctgatatttgggcagcagcatcaaga
gtattagaagcagctgttcaaaaagcgtataatggagagcgtggcatcgtctggaaggaa
gttttagctggagaaaaagcttacaatgcaactggcgaatggcttcctgctgaaacatta
gatgctgtacgtgaatatatgattgcaattaaagggcctttaacaactcctgttggcgga
ggaattcgttctttaaacgttgctcttcgtcaagagttagacttatttgtttgcttacgt
cctgttcgctactttacaggtgttccatctcctgttaaacgtcctgaagatacagacatg
gttatcttccgtgaaaatacagaagatatttatgctggtattgaatatgaaaaaggttca
gaagaagtgaaaaaacttattgacttccttcaaaatgaaatgggagtaaataaaattcgc
ttcccagaaacatctggtattggaattaagcctgtatcagaagaggggacaaaacgtctt
gtacgtggtgcaatcaactacgcaattagtgaaggacgtaaatctgtaacccttgtacat
aaagggaacattatgaaatttacagaaggcgcatttaaaaattggggctatgagctagct
gaacaagagtttggggataaagtattcacatgggctcagtatgatcgccttgttgaaaca
gaaggtaaagaagcagcaaataaagcacaagatgaggctgttgaagctggaaaaattatt
gtgaaagattctattgctgatatcttcttacaacaaatcctaacacgtccaagtgagttc
gatgttgtggcgacaatgaacttaaatggcgactatatttcagatgctcttgcagcacaa
gttggtggaattggaattgctccaggagcaaacatcaactatgaaactggacatgctatt
ttcgaagcaacacacggtacagctccgaaatacgctggtcttgataaagtaaatccatct
tctgttattctttcaggtgtactaatgcttgaacacttaggatggaaagaagcagcagat
cttgtaatgagcgcaatggataaaacaattgcttctaaagtcgtaacatatgactttgct
cgtttaatggacggagcaacagaagtgaaatgctctgagtttggcgataagctaattcaa
aatatggaagaagaagtaacagtataa

DBGET integrated database retrieval system