KEGG   Theileria equi: BEWA_016000Help
Entry
BEWA_016000       CDS       T02820                                 

Definition
(RefSeq) flavoprotein subunit of succinate dehydrogenase, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
beq  Theileria equi
Pathway
beq00020  Citrate cycle (TCA cycle)
beq00190  Oxidative phosphorylation
beq01100  Metabolic pathways
beq01110  Biosynthesis of secondary metabolites
beq01130  Biosynthesis of antibiotics
beq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:beq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BEWA_016000
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BEWA_016000
Enzymes [BR:beq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BEWA_016000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 15802703
NCBI-ProteinID: XP_004832491
LinkDB All DBs
Position
4
AA seq 641 aa AA seqDB search
MQTLLGFKVISWLYPHSNPYASLYYIFTDYTCIIIYSYTFSGYKIVHHDFDAVVVGAGGA
GLRAALELSQLGYKTACISKLFPTRSHTVAAQGGINAALGNMCEDDWRWHAYDTVKGSDW
LGDQDAIHYMCKQAPEAVIELENYGLPFSRTEEGKIYQRAFGGQTLKFGKGGQAYRCAAA
ADRTGHAMLHTLYGQALNHQCKFFIEYFLLDLIMHNGACVGCVCMRMSNGEIHVFRAPHN
VLCTGGYGRCYLSCTSAHMCTGDGNAAVARAGLPLQDMEFVQFHPTGIFPAGCLITEGCR
GEGGILRNAEGEAFMARYAPVAKDLASRDVVSRAMTIEIMEGRGCGPNRDHLYLDLTHLS
AEVLHERLPGIVETAKIFAGVDANVQYIPVLPTVHYNMGGIPTNWKAEALSHDGKSCSTV
VPGLYAAGEAACASVHGANRLGANSLLDILVFGKRAALSIHETNQAGSLPSVGAGLEASI
DACVDKCVDRVENLVNGPGSTSVAELRDSMQRIMQKHVSVFRDGSSLQEGVEKLSQVCKA
YKDVKVQDKSLVFNTDLYEAMELENLLTLAMQTVVSAEARKESRGAHARDDFPKRDDANW
RKHTLSYMNGNLEDVKITYRDVIDSTLGGDMDTIPPFERTY
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcagactttacttggtttcaaagtgatctcttggctttatccgcactctaatccatat
gcttcactatattatatattcaccgactacacttgtataatcatatattcatacactttt
tcaggctataaaatcgtccatcatgattttgatgcggtagtagttggagctggaggtgcc
ggcctccgcgctgctcttgagctctcccaattgggttacaagacagcttgtatatctaaa
ctatttcccacccgttctcacactgtagcagctcaaggcggtataaatgcagccttaggt
aacatgtgtgaagatgactggaggtggcatgcctatgatacagtcaaaggatcagattgg
ttgggggatcaggatgccattcattacatgtgcaaacaagcacctgaagcagttatagaa
cttgaaaactacggacttccgttctcaagaacggaggagggaaagatatatcagagagcc
tttggaggtcagactttaaagtttggaaagggtggtcaggcttatcgctgtgcagcggct
gctgatagaacaggccacgctatgcttcataccctttatggtcaagcactaaatcaccaa
tgcaagttttttatcgaatattttttgctagaccttatcatgcacaacggagcctgtgta
ggttgtgtatgcatgagaatgagtaatggagaaatccatgttttccgtgctcctcataat
gtgctttgcacaggaggttacggtagatgctatctctcttgtacttcagcccacatgtgc
acaggagatggtaatgcagctgttgctcgtgctggtttgccccttcaagatatggaattc
gtgcagttccatccgacaggtatcttccctgctgggtgccttatcacagagggatgcaga
ggagaaggtggtatccttagaaatgccgaaggagaagcttttatggcaagatatgctcca
gttgcgaaggatttggcgagcagagacgttgtctctcgcgccatgactatcgagattatg
gaaggccgtggatgtgggccaaatcgtgatcatctttatttggatttaacacatttgtca
gcagaggttcttcacgagagacttcctggaattgtcgaaacagcaaagatctttgcgggt
gtagatgctaatgtgcaatacatacctgtgctgccaaccgtgcactataacatgggcggt
attccaacaaactggaaggcagaggcattatctcatgatggaaagtcttgttcaactgta
gtaccaggtttatatgctgctggagaagctgcatgtgcatcagtccatggagccaatcgt
cttggtgcgaactcgcttttggacattttagtttttggaaaacgtgccgcacttagcatt
cacgaaacgaatcaagctgggtctcttccaagcgtcggagctggcctagaagcatcgatc
gatgcatgcgttgataagtgtgttgatagggttgaaaaccttgtaaacggaccaggaagt
acaagtgtagctgaactgagagattctatgcaaaggataatgcaaaaacatgtttctgtc
ttcagagatggaagttctctacaggagggagttgaaaaactcagccaagtatgtaaagca
tacaaggatgtaaaggttcaggacaagtctttggtttttaatactgatttatatgaagct
atggaattggaaaacttactaacacttgctatgcaaactgttgtctctgcagaagcgaga
aaggagtctaggggtgcgcatgcacgtgatgacttcccaaaacgtgacgatgccaactgg
agaaagcatacactttcatacatgaacggaaacttggaagatgttaaaataacatacaga
gatgtaatagactctacactgggtggtgatatggacactattccaccgtttgaaagaaca
tactag

DBGET integrated database retrieval system