KEGG   Bdellovibrio exovorus: A11Q_1050Help
Entry
A11Q_1050         CDS       T02492                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bex  Bdellovibrio exovorus
Pathway
bex00473  D-Alanine metabolism
bex00550  Peptidoglycan biosynthesis
bex01100  Metabolic pathways
bex01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bex00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A11Q_1050
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A11Q_1050
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A11Q_1050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bex01011]
    A11Q_1050
Enzymes [BR:bex01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A11Q_1050
Peptidoglycan biosynthesis and degradation proteins [BR:bex01011]
 Precursor biosynthesis
  Amino acid ligase
   A11Q_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 ATP-grasp CPSase_L_D2 ATPgrasp_YheCD GARS_A
Motif
Other DBs
NCBI-ProteinID: AGH95266
UniProt: M4VB67
LinkDB All DBs
Position
1063512..1064513
Genome map
AA seq 333 aa AA seqDB search
MRALKILLLFDLSVNIPTEEYGEYWKTPDWKTEKDVKDALTRLGHEVIPLGIHNDIEHLL
KTVQVLKPDLVFNLSEAFNGNRDFEPNMAALMQLIGVPFTGTGPLGLQLCKDKGLTKVIL
SHHRIRTPRFLVAKKSHPLRSLKKFQFPAFVKPLQLESSEGISQLSYVENEKDALARVKY
IHERLEVDAIVEEFIDGRELYVGILGNEKLTVFPPRELFFKEVPDDEPKFATFRSKWDQE
YRKKWGIDSGWAASMPEAMQKKLNETCKKIYRLLHIQGYGRIDLRVKENGEIYFIEANPN
PSISKSEDFALSAGKADLSYDDLMAKIISLAMS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgagggctttaaaaattttgcttctatttgatctttccgtaaatattccaacggaagag
tatggtgagtactggaagactcctgactggaaaactgaaaaagatgtgaaggatgcactg
actcgtttagggcatgaagtgattcctttaggaatacataatgatatcgaacatcttttg
aaaacagttcaagtgctgaagcctgatttagtatttaacttgagtgaagcttttaatggg
aacagagactttgaacccaatatggcagccctcatgcaattgatcggtgtgccatttaca
ggaacggggccactagggcttcagttgtgtaaagataaaggactgacaaaagttatttta
agccatcatcgcattcgtacgccacgttttttagtggcgaaaaaatctcatcctttacgt
tcgctcaaaaagtttcaatttccagcctttgttaaaccattacagctagagtcatcagag
ggaatttcacaactttcctatgttgaaaatgaaaaggatgctctagcccgagtgaagtat
attcacgagcgtttggaagtagatgcgattgtggaagagtttattgatggacgtgagctc
tatgtgggtatcttgggaaatgaaaagttaactgtatttccaccacgtgagctctttttt
aaagaagtgccggatgatgaacctaagttcgcgacatttcgtagtaaatgggatcaagag
tatcgtaaaaaatggggtattgattctggatgggctgcctctatgcccgaagctatgcag
aaaaaattgaatgagacatgtaagaaaatatatcgtctactgcacattcaaggttatgga
cgtattgatttgcgcgtaaaagaaaacggcgaaatttacttcattgaagccaatcccaat
ccttctatctcaaaaagcgaagacttcgccttatcagcaggtaaagctgacctcagctac
gatgatttgatggcgaaaatcatttccttagctatgtcataa

DBGET integrated database retrieval system