KEGG   Brachybacterium faecium: Bfae_00540Help
Entry
Bfae_00540        CDS       T00965                                 

Definition
(RefSeq) dihydroxyacetone kinase
  KO
K20901  L-erythrulose 1-kinase [EC:2.7.1.209]
Organism
bfa  Brachybacterium faecium
Brite
KEGG Orthology (KO) [BR:bfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bfae_00540
Enzymes [BR:bfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.209  L-erythrulose 1-kinase
     Bfae_00540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-GeneID: 8398604
NCBI-ProteinID: YP_003153528
UniProt: C7MF38
LinkDB All DBs
Position
complement(53157..54872)
Genome map
AA seq 571 aa AA seqDB search
MTYLFNDPADFATEAVAGLALSHPEHVAVVHGGVVRATETPKGQPALVIGGGSGHYPAFA
GWVGPGMGHGAPCGNIFSSPSASQVYSVARNAENGGGVVLGFGNYAGDVLHFGAAAEKLR
AEGVDVRIIKVSDDIVSNSPENHRDRRGIAGDLPVFKIAGAAIEAGADLDEAERLAWKAN
DATRSFGVAFDGPTLPGAEDALFHVPDGQMGVGLGIHGEPGVREEPIGTADDIAAMLVEG
VLAEQPERAEGGYQGRAAVLVNGLGTVKYEELFVVYAKVAELLEQAGITPVRPEVGELVT
SLDMSGLSLTLVFLDEELEQHWLAPVDTPAFHRGAMPPVDRPRRTSFWEAGADETPASSE
ESRAAAAKVAGVLELFESVCAREEAELGRIDAIAGDGDHGQGMAYGSKGAAAAAREALEA
GAGARTLLVRAGEAWSESAGGTSGALWGAALIAAGSVFDDQAGAEPRTVVDAVDAGIDAV
QRLGGAQVGDKTMVDAAAPFREALDAAFTGDDAAAAILQAAQVAREAADATADITATLGR
SRVLGEKSIGTPDPGAISFSILMKELGQHLS
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacctcttcaacgacccggcagatttcgcgaccgaggcggtcgcggggctcgcc
ctgtcccatcccgagcacgtcgccgtcgtccacggcggcgtggtccgcgcgaccgagacc
ccgaagggccagccggccctggtgatcggcggcggctccggccactaccccgccttcgcg
ggctgggtgggcccgggcatggggcacggcgccccctgcggcaacatcttctcctcgccg
tcggcctcgcaggtctactccgtcgcccgcaacgcggagaacggcggcggcgtggtgctg
ggcttcggcaactatgccggggacgtgctgcacttcggcgccgcggcggagaagctgcgc
gccgagggcgtggacgtgcggatcatcaaggtcagcgacgacatcgtctccaactccccc
gagaaccatcgcgaccgccgcggcatcgccggcgacctgccggtgttcaagatcgccggc
gccgcgatcgaggcgggcgcggatctcgacgaggccgagcgcctcgcctggaaggccaac
gacgccacccgctccttcggcgtcgccttcgacggccccacgctccccggtgcggaggac
gccctgttccatgtcccggacgggcagatgggcgtgggcctgggcatccacggcgagccc
ggggtgcgcgaggagccgatcggcacggcggatgacatcgcggcgatgctggtcgagggc
gttctggccgagcagccggagcgcgccgagggcggctaccagggccgcgccgcggtgctc
gtcaacggtctcggcacggtgaagtacgaggagctgttcgtcgtctatgcgaaggtcgcc
gagctgctcgagcaggcggggatcacgccggtgcggcccgaggtgggcgagctcgtcacc
agcctggacatgtccgggctctccctgaccctggtgttcctcgacgaggagctcgagcag
cactggctcgcgccggtggacaccccggccttccaccgcggcgcgatgccgccggtggac
cggccccgtcgcacctccttctgggaggcgggggccgatgagacgcccgcctcgagcgag
gagtcccgtgccgcggcggcgaaggtcgccggcgtgctggaactcttcgagagcgtgtgc
gcgcgggaggaggccgagctcggccggatcgatgcgatcgccggcgacggcgaccacggc
cagggcatggcctacggctcgaagggcgctgcggccgcggcgcgggaggctctcgaggcc
ggcgccggggcgcgcaccctgctggtccgtgccggcgaggcatggtccgaatcggccggc
ggcacctccggtgcgctgtggggcgcggcgctgatcgcggccggcagcgtgttcgacgac
caggccggtgccgagccccgcaccgtggtcgacgcggtcgacgccggcatcgacgccgtc
cagcgcctgggcggtgcgcaggtgggcgacaagaccatggtcgacgccgccgcacccttc
cgggaggcgctggatgcggcgttcaccggggacgacgccgcggccgcgatcctgcaggcc
gcgcaggtcgcccgcgaggcggccgacgccaccgcggacatcaccgcgaccctgggccgc
tcccgcgtgctcggggagaagtcgatcggcacccccgatcccggcgcgatctccttctcg
atcctcatgaaggagctcgggcagcacctgtcctga

DBGET integrated database retrieval system