KEGG   Brachybacterium faecium: Bfae_07110Help
Entry
Bfae_07110        CDS       T00965                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bfa  Brachybacterium faecium
Pathway
bfa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Bfae_07110
Enzymes [BR:bfa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bfae_07110
DNA repair and recombination proteins [BR:bfa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bfae_07110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 8399259
NCBI-ProteinID: YP_003154158
UniProt: C7M9M4
LinkDB All DBs
Position
809835..812378
Genome map
AA seq 847 aa AA seqDB search
MATREQQVEIDGRRLKLSNLDKVLYPQTGTIKGEVIDYYHRIAPVLVPQATRRPATRKRW
VDGVGTAQSPGKVFFRKDLESHAPQWVPRADIQHSDGTSTYPLVDEPAVLVWLAQLAALE
VHTPQWRFDDALAPAPPDRLVLDLDPGEGAGLPECARVAAWCREILTDMGLESYPVTSGS
KGIHLYAPLDGSADSEEVDAVAHELARALETDHPEEVISTQTRAKRAGKVLVDWSQNNGS
KTTVCPYSLRGRLRPTVAAPRTWEEVEDPALAQLELDEVLARVEDGVDPLAPLGLAAEGD
AEETGPSSAGRARDRLEAYRAKRDPERTPEPVPEAGIGSDAAQEALEDEEPMFVIQEHHA
SSLHWDFRLQHAGVLVSWAVPKGPPLEVDVKRLAVQTEDHPLEYGTFEGTIPEDEYGGGD
VTLWDAGSIEIEKWREDREVIVVCHGRPDGGLGGVPRRFVFLHTGGMRGGRRTAAAKEKA
EANWLLHLMKDQPEPDASRSDDAAPAPEDDAAAPEDAPVAELGEPLAPMLATLGRREDIR
DEDDWAYEMKWDGVRVIATVRGTTVRLTSRGGKDMTAAFPELAELLDAVEPALREAGETV
LDGEIVALDRHDRPSFSRLQQRLGLTRQRDVDRARQQVEAHVMLFDLLVRGGDSLLRTPY
RERREQLFAAVHATEHVQLPHADHGEVEEAIALSKRLQLEGVMAKKESGVYQPGKRTRTW
IKLKNARHQEVVVIGWRHGKGERSGSLGSLLLAVPDSEGELRYAGRVGTGFTDRDLEEIA
ARLRSRSRKTPPVDDVPAADRRDAEWVRADLVGEVQHTERTADGRLRHPVWRGWRPEKNV
ADLQWES
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcgagagcagcaggtggagatcgacgggcgcaggctgaagctgtcgaatctc
gacaaggtcctctacccgcagaccggcaccatcaagggcgaggtgatcgactactaccac
cgcatcgccccggtgttggtgccgcaggcgacccgccgccccgccacccgcaagcgctgg
gtcgacggcgtgggaaccgcccagtccccggggaaggtgttcttccgcaaggacctcgag
agccacgccccgcagtgggtcccccgcgccgacatccagcacagcgacggcacctcgacc
tacccgctggtggacgagccggcggtcctggtctggctcgcccagctcgccgcgctcgag
gtccacacgccccagtggcgcttcgacgacgcgctcgccccggcccctcccgaccggttg
gtcctcgacctggaccccggcgagggggcggggctgccggagtgcgcccgggtggccgca
tggtgccgcgagatcctcacggacatggggctcgagagctacccggtcacctccggctcc
aagggcatccacctctatgcgcccctggacggcagcgccgactccgaggaggtggacgcg
gtcgcccacgagctcgcccgtgcgctggagaccgaccaccccgaggaggtcatcagcacc
cagacccgtgcgaagcgcgccggcaaggtgctcgtggactggtcgcagaacaacggcagc
aagaccaccgtgtgcccgtactcgctgcgcgggcgcctgcgccccaccgtcgccgccccg
cgcacctgggaggaggtcgaggatcccgcgctcgcgcagctcgagctcgacgaggtgctc
gcccgggtcgaggacggcgtcgaccccctcgcgcccctcggcctcgcggctgagggcgac
gccgaggagaccggcccgtcgtcggccggacgggcacgcgaccgcctcgaggcgtaccgc
gcgaagcgggacccggagcgcacgcccgagcccgtgccggaggcgggcatcggcagcgac
gccgcgcaggaggccctcgaggacgaggagccgatgttcgtcatccaggagcaccacgcc
tcgagcctgcactgggacttccgcctccagcatgcgggggtgctcgtctcctgggcggtg
ccgaaggggccgccgctcgaggtcgacgtgaagcgcctggcggtgcagaccgaggaccac
cccctcgagtacggcaccttcgagggcaccatccccgaggacgagtacggcggcggggac
gtcaccctctgggacgccggctcgatcgagatcgagaagtggcgcgaggaccgcgaggtg
atcgtggtgtgccacggccggcccgacggtgggctcggcggggtgccgcgccgcttcgtc
ttcctccacaccggcgggatgcgcggagggcgccgcaccgccgcggcgaaggagaaggcg
gaggcgaactggctgctgcacctcatgaaggaccagcccgagcccgacgcgtcgcgctcc
gacgacgccgcccccgcccccgaggacgacgccgccgcccccgaggacgcccccgtcgcc
gagctgggcgagccgctcgccccgatgctcgcgaccctcgggcggcgcgaggacatccgc
gacgaggacgactgggcctacgagatgaaatgggacggcgtgcgcgtgatcgcgacggtc
cgcggcacgacggtgcgcctgaccagccgcggcggcaaggacatgaccgccgcgttcccc
gagctggccgagctcctcgacgcggtggagcctgcgctgcgggaggcgggggagacggtg
ctcgacggggagatcgtggccctggaccgccacgaccggccctccttctcccgcctccag
cagcgcctgggactgacccggcagcgggacgtggaccgcgcccggcagcaggtcgaggcg
cacgtgatgctcttcgacctgctcgtgcggggcggggactcgctgctgcgaacgccctac
cgcgagcggcgcgagcagctgttcgccgcagtgcacgccaccgagcacgtccagctcccg
cacgccgatcacggcgaggtcgaggaggcgatcgccctgtcgaagcggctccagctcgag
ggcgtgatggcgaagaaggagagcggcgtctaccagccgggcaagcgcacccgcacctgg
atcaagctcaagaacgcccggcaccaggaggtggtggtgatcggctggcggcacggcaag
ggggagaggtccggatcgctggggtccctgctgctcgccgtcccggactccgagggcgag
ctgcgctacgcaggccgcgtcggcaccgggttcaccgaccgcgacctcgaggagatcgcc
gcccggctccgctcccggtcccggaagaccccgcccgtcgatgacgtccccgcggcggac
cggcgcgatgccgaatgggtgcgcgcggacctggtgggggaggtgcagcacaccgagcgc
acggccgacgggcggctgcgtcacccggtgtggcgcggatggcggcccgagaagaacgtc
gctgacctgcagtgggagtcctga

DBGET integrated database retrieval system