KEGG   Brachybacterium faecium: Bfae_07300Help
Entry
Bfae_07300        CDS       T00965                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00620  Pyruvate metabolism
bfa00680  Methane metabolism
bfa01100  Metabolic pathways
bfa01120  Microbial metabolism in diverse environments
bfa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bfae_07300
  Energy metabolism
   00680 Methane metabolism
    Bfae_07300
Enzymes [BR:bfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Bfae_07300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 8399278
NCBI-ProteinID: YP_003154176
UniProt: C7M9P2
LinkDB All DBs
Position
829500..832328
Genome map
AA seq 942 aa AA seqDB search
MPHSDAIAVPTLTSEFPVVGDDPHIDAPLRATVRRLSTLLGGALADQHGQEMLDLVEQVR
KLTKEAKSADSEASAQDVQKRLAELPIEQATALTRAFSQYFLLANAAEQVYRVRALDERP
SAESWVPRTVRDIHEEVGTDGLQQAVDSLDVRLVFTAHPTEASRRAVLTKLRRISDILGE
DTEEGTPERRRQDRDLAELIETLWQTDELRRQRPTPQDEARNALYYLREIFRHTMPEMLD
DLREELRAHGANLRDDQVPLRFGSWIGGDRDGNPFVTAQVTREVLKLQAETSIDFAIEVI
SELILELSVSSELTGEDEELRASLAEDLQHNSEVDEVQQELYHEEPYRLKLGAMRSKLNA
TRERIRTGEAHVHGRDYSDSAELQEDFRVLREALHRHGGERAADGTLAIAQQVLAASGLN
LATLDVREHSEKHHDVLSRLFDRVGELDRPYAELSREERTTVLGRELGSRRPLVGSAITE
DESTLDDATRTTYNVFREIRDAHRLYGTSVIETYIISMTHGADDVLAAALLAREAGLLSI
AGSEERRADIGFVPLLEEVSELRHAGEILDELLSDPSYREIVRLRGDRQEVMLGYSDGNK
DAGVITSQWEIHQAQRSLRDTAARHGVTLRLFHGRGGSVGRGGGPTYDAILAQPYGVLEG
EIKFTEQGEVISDKYMLPSLARENLDLSLAAVLEGSALHTAPRTPAETLERFGDVMQSVS
DSSFARYRTLVDDENLPEYFVSATPVEQLGDLNIGSRPSKRTTSEKGLDGLRAIPWVFGW
TQSRQIVPGWFGAGSGLKAAREAGLEPDLHEMYRSWHFFRTVISNVEMTLAKTDMQIAAH
YVHSLVPERLWYLFDRIREEYELSVAEIERLTGVLGLLDNQPVLKRTLSVRDRYLDPISY
MQVAMLQRARAATARGEELSPELQRALLTTINGVAAGLKNTG
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
gtgccacattccgacgccatcgccgtcccgacactgacgagcgagttccccgtcgtcggc
gacgacccccatatcgacgccccgctgcgggcgacggtccgccgcctgtccaccctgctg
ggcggcgccctcgccgaccagcacgggcaggagatgctcgacctcgtcgagcaggtccgc
aagctcaccaaggaggcgaagtccgccgattccgaggccagcgcccaggacgtccagaag
cgtctggccgagctgccgatcgagcaggccaccgccctcacccgggcgttctcccagtac
ttcctgctggccaacgctgcggagcaggtctaccgcgtgcgcgccctggacgagcggccc
tcggccgagtcgtgggtgccgcgcacggtgcgcgacatccatgaggaggtcggcaccgac
ggcctgcagcaggccgtggactcgctcgacgtgcgcctggtcttcaccgcgcaccccacc
gaggcctcccgccgcgccgtgctgacgaagctgcgccgcatctcggacatcctcggcgag
gacaccgaggagggcactcccgagcggcgccggcaggatcgtgatctggccgagctcatc
gagacgctgtggcagaccgacgagctgcgccgccagcgccccaccccgcaggacgaggcc
cgcaacgccctgtactacctgcgcgagatcttccgccacaccatgccggagatgctcgac
gacctgcgcgaggagctgcgcgcccacggcgcgaacctgcgcgacgaccaggtgccgctg
cgtttcggctcctggatcggcggcgaccgcgacggcaaccccttcgtcaccgcacaggtc
acccgcgaggtgctgaagctgcaggcggagacgtcgatcgacttcgccatcgaggtgatc
tccgagctgatcctcgagctgtccgtctcgagcgagctcaccggcgaggacgaggagctg
cgtgccagcctcgccgaggacctccagcacaactccgaggtcgacgaggtccagcaggag
ctgtaccacgaggagccctaccgcctgaagctcggggcgatgcggtccaagctgaacgcc
acgcgcgagcggatccgcaccggtgaggctcacgtccacggccgcgactacagcgacagc
gccgagctgcaggaggacttccgggtgctgcgcgaggcgctgcaccgtcacggcggcgag
cgtgccgccgacggcaccctcgccatcgcgcagcaggtgctcgcggcctccggcctcaac
ctcgccacgctcgacgtgcgtgagcactccgagaagcaccacgacgtgctctcccgcctg
ttcgaccgcgtgggggagctggaccgcccgtacgcggagctcagccgcgaggagcgcacc
acggtgctgggacgggagctggggagccgccggccgctggtcggctcggcgatcaccgag
gacgagtcgaccctcgacgacgccacccgcaccacctacaacgtgttccgcgagatccgc
gacgcgcaccgcctgtacggcacctccgtgatcgagacgtacatcatctcgatgacccac
ggcgccgacgacgtgctcgccgcggcgctgctggcccgcgaggccggcctgctcagcatc
gccggcagcgaggagcgccgcgcggacatcggcttcgtgccgctgctggaggaggtctcc
gagctgcgtcacgccggggagatcctcgacgagctgctcagcgacccctcctaccgggag
atcgtgcgcctgcgcggcgaccggcaggaggtcatgctcggctactccgacggcaacaag
gacgccggcgtgatcaccagccagtgggagatccaccaggcccagcgctcgctgcgcgac
acggcggcccgtcacggcgtgaccctgcgcctgttccacggccgcggcggctccgtcggc
cgcggcggcggccccacctatgacgcgatcctggcccagccgtacggcgtgctcgagggc
gagatcaagttcaccgagcagggcgaggtcatctccgacaagtacatgctgccgtcgctg
gcccgggagaacctggacctgtcgctggccgcggtgctcgagggctcggcgctgcacacc
gcgccgcgcaccccggcggagaccctggagcgcttcggcgacgtcatgcagtcggtctcc
gactcgtcgttcgcgcggtaccgcaccctcgtggacgacgagaacctgccggagtacttc
gtctccgccaccccggtcgagcagctgggcgacctgaacatcggctcgcgcccctccaag
cgcaccacctcggagaagggcctggacggcctgcgggcgatcccgtgggtgttcggctgg
acccagtcgcggcagatcgtgccgggctggttcggggcgggctccggcctgaaggccgca
cgcgaggcgggcctcgagcccgatctgcacgagatgtaccgcagctggcatttcttccgc
accgtgatcagcaacgtcgagatgaccctcgcgaagacggacatgcagatcgccgcgcac
tacgtgcactccctggtgccggagcggctgtggtacctcttcgaccggatccgtgaggag
tacgagctctcggtcgcggagatcgagcgtctcaccggcgtgctgggcctgctggacaac
cagcccgtgctcaagcgcaccctgtcggtgcgcgaccgctacctggatccgatctcctac
atgcaggtcgcgatgctgcagcgggcccgggcggcgaccgcgcggggcgaggagctctcc
cctgagctgcagcgcgccctgctgaccaccatcaacggtgtcgcggccggcctgaagaac
accggctga

DBGET integrated database retrieval system