KEGG   Brachybacterium faecium: Bfae_08300Help
Entry
Bfae_08300        CDS       T00965                                 

Definition
(RefSeq) BNR/Asp-box repeat protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00511  Other glycan degradation
bfa00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bfae_08300
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bfae_08300
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Bfae_08300
Bacterial toxins [BR:bfa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Bfae_08300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR BNR_3 DUF4185
Motif
Other DBs
NCBI-GeneID: 8399378
NCBI-ProteinID: YP_003154274
UniProt: C7M9Z0
LinkDB All DBs
Position
complement(946984..948210)
Genome map
AA seq 408 aa AA seqDB search
MEPSLTRRGLLGTAAALTAAGAGAVAAASPAAALPPIKDNGRRQGSYEEQVLAAPGDWGV
PNFRIPALAVAPNGDLLAAFDKRPVHGDSPAPNSIWQRRSRDGGRTWEEPTVVRAGLESE
EPGEKLGYSDPSYVVDTETGTLFLFCVFSKDTGVWDSEYGNDDADRRIQSANLSVSHDSG
ETWEHRSLTEVVKPEDCRAMFATSGAGIQLRYGKHRGRLIQQYAGWFRGEGGEEDVSAYS
VYSDDHGETWTMGTPVGTEMDENKVAELSDGTVMLNSREHVRTGRRWVALSHDGGETWED
LHRDPHLVDPGNNAHLTRAYPEAPQGSAKAQVLLFSHADHEPDDRVNGTVEISTDDGATW
ERKRVFAPGPCQYSVLIPVARDEFLLAYEGEDETLLIARLDMDWILSR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgtccctgacccgccgcggcctgctcggcaccgccgccgccctcaccgccgcc
ggcgccggtgccgtcgcggccgcgagcccggccgccgccctgcccccgatcaaggacaac
ggccgccgccagggcagctacgaggagcaggtgctcgccgctcccggcgactggggggtg
ccgaacttccgcatccccgccctcgcggtcgccccgaacggcgatctgctggccgccttc
gacaagcgccccgtgcacggcgactcccccgccccgaactcgatctggcagcgccgctcc
cgcgacggtgggcgcacctgggaggagccgacggtggtgcgagcgggcctcgaatccgag
gagcccggcgagaagctcggctactccgacccctcgtacgtggtcgacaccgagaccggc
accctcttcctgttctgcgtgttctcgaaggacaccggcgtgtgggacagcgagtacggc
aacgatgacgcggaccgccgcatccagagcgcgaacctcagcgtcagccatgactcgggc
gagacctgggagcaccgctccctcaccgaggtggtcaagccggaggactgccgcgccatg
ttcgccacctccggcgcgggcatccagctgcgctacgggaagcaccggggccgcctgatc
cagcagtacgcgggctggttccggggcgagggcggcgaggaggacgtctccgcatactcc
gtctactccgacgaccacggcgagacgtggaccatgggcaccccggtgggcaccgagatg
gacgagaacaaggtcgccgagctctccgacggcaccgtgatgctgaactcccgcgagcac
gtgcgcacgggccggcgctgggtggcgctgagccacgacggcggagagacctgggaggat
ctgcaccgcgatccgcacctcgtggacccgggcaacaacgcgcacctcacccgcgcctac
ccggaggccccgcagggttccgcgaaggcgcaggtgctgctgttctcgcatgcggaccac
gagccggacgaccgcgtgaacggcaccgtcgagatctcgaccgacgacggcgcgacctgg
gagcgcaagcgcgtgttcgcgcccgggccgtgccagtactcggtgctcatccccgtggcc
cgcgacgagttcctcctcgcctacgagggcgaggacgagacgctcctgatcgcgcgcctg
gacatggactggatcctgtcgcgatga

DBGET integrated database retrieval system