KEGG   Brachybacterium faecium: Bfae_28190Help
Entry
Bfae_28190        CDS       T00965                                 

Definition
(RefSeq) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00040  Pentose and glucuronate interconversions
bfa00051  Fructose and mannose metabolism
bfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bfae_28190
   00051 Fructose and mannose metabolism
    Bfae_28190
Enzymes [BR:bfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Bfae_28190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 Pyr_redox_2 YdfZ
Motif
Other DBs
NCBI-GeneID: 8401363
NCBI-ProteinID: YP_003156174
UniProt: C7MHR7
LinkDB All DBs
Position
3162850..3163887
Genome map
AA seq 345 aa AA seqDB search
MSAALPKAPEATMRVSALHGVGDLRLTERPVPVPGRGEVLVRVAAVGVCGSDTHYYTQGR
IGPFVVDRPLVLGHEASGRIVGVGEAVDPRRIGSRVSIEPQRPCRSCTECKAGRYNLCPH
MEFFATPPIDGAFAEMVVIEDDFAHDVPDSISDAAAALVEPLSVGIWACQKACIGAGSRV
LIAGAGPVGIIIAQVAGAFGASEVHISDLSDERLGFARAHGATHTHRADSPVDDLGVDAF
IDASGAEPAIRAGISAVRPAGSVVLVGLGADEAVLPVNLLQNRELVLTGVFRYANTWPLA
IRLLAEGRIDLDCLVTGRHGLADAESALTSGSTPRSMKSLVMPQL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcactcccgaaggctccggaggccaccatgagggtgtcagccctgcacggc
gtcggcgacctccgcctcaccgaacgccccgtgcccgtccctgggcgcggcgaggtgctg
gtgcgcgtcgccgcggtgggcgtctgcggcagcgacacgcactactacacccagggccgc
atcggaccgttcgtggtggatcggccgctcgtcctcgggcatgaggcatccggccgcatc
gtcggcgtcggagaggcggtcgatccgcgccgcataggttcgcgcgtctcgatcgaaccc
cagcggccatgccgcagctgcaccgaatgcaaggcggggaggtacaacctctgcccgcac
atggagttcttcgcgaccccgcccatcgatggcgccttcgcggagatggtggtcatcgag
gacgacttcgcccatgacgtccccgactccatcagcgatgccgcagcggctctcgtcgaa
ccgctctcggtcggcatctgggcatgccagaaggcatgtatcggcgccggctctcgggtg
ctgatcgccggtgcagggccggtgggcatcatcatcgcgcaggttgctggagcattcggg
gcttccgaggtgcacatcagcgacctctccgacgagcggctcggcttcgctcgggcacac
ggtgccacgcacacccaccgcgccgattcccctgtcgatgacctcggcgtcgacgcattc
atcgatgcgtcgggggccgagcccgcgatccgggcgggcatctcggccgtccggcccgct
gggtcggtcgtgctcgtcgggctcggcgcggatgaggcggtgctgccggtcaacctgctc
cagaaccgcgagctggtgctcaccggcgtcttccgctacgccaacacgtggccgctcgcg
atccgtctgctggcggaggggcgaatcgacctggactgcctggtgacggggcggcacggg
ctcgccgacgccgaatccgcgctcacctcgggctccacaccgcgaagcatgaagtcgctg
gtcatgccgcagctctga

DBGET integrated database retrieval system