KEGG   Bacteroides fragilis BOB25: VU15_02585Help
Entry
VU15_02585        CDS       T03897                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bfb  Bacteroides fragilis BOB25
Pathway
bfb00240  Pyrimidine metabolism
bfb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    VU15_02585
Enzymes [BR:bfb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     VU15_02585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK FUR zf-C4pol
Motif
Other DBs
NCBI-ProteinID: AKA54070
UniProt: A0A0K6BPP7
LinkDB All DBs
Position
complement(642448..643047)
Genome map
AA seq 199 aa AA seqDB search
MVLFSEDHIQETRRRGRIEVICGSMFSGKTEELIRRMKRAKFARQRVEIFKPAIDTRYSE
GDVVSHDSNSISSTPIDSSASILLFTSEIDVVGIDEAQFFDSGLIDVCNQLANNGVRVII
AGLDMDFKGVPFGPMPALCAIADEVSKVHAICVKCGQLASFSHRTVKNDKQVLLGETAQY
EPLCRECYQRALQEDREKS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggtattattttcagaagatcatatacaagagactagaagaagaggaagaatcgaagta
atttgcggctctatgttttccggaaaaacggaagagttgattcgccgcatgaagcgggct
aagttcgctcgtcaacgtgtagagatattcaaacctgccattgacacccgctattcggaa
ggcgacgttgtttcacacgacagtaattccatttcctccacacccattgactcttctgca
agcattttgctctttacatccgaaatagatgtagtaggcatcgacgaggcacagttcttc
gacagtggattgatagatgtatgcaatcaactggccaataacggagtgcgtgtcattata
gccggattggacatggatttcaaaggagttccttttggcccgatgcccgctctatgcgct
attgccgacgaagtttcgaaagtacatgccatctgcgtgaaatgcggacagttggcctct
ttttcacaccgtaccgtaaagaatgacaaacaagttttactgggggaaacagcccaatac
gagccgctctgtcgggaatgttaccaacgcgctttacaagaagatcgagaaaaatcataa

DBGET integrated database retrieval system