KEGG   Bacteroides fragilis BOB25: VU15_03790Help
Entry
VU15_03790        CDS       T03897                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bfb  Bacteroides fragilis BOB25
Pathway
bfb00473  D-Alanine metabolism
bfb01100  Metabolic pathways
bfb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bfb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VU15_03790
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VU15_03790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bfb01011]
    VU15_03790
Enzymes [BR:bfb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VU15_03790
Peptidoglycan biosynthesis and degradation proteins [BR:bfb01011]
 Precursor biosynthesis
  Racemase
   VU15_03790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C LodA_C
Motif
Other DBs
NCBI-ProteinID: AKA50912
LinkDB All DBs
Position
complement(970350..972845)
Genome map
AA seq 831 aa AA seqDB search
MSYTIESIVEKIGARRLGNKPAAIDWLLTDSRSLCFPEETLFFAIPTKRNNGARYIPDLY
ERGVRNFVVTSEDFKGLTMDSEQLKVTMAQECNFLIVPNTLKALQKLAEQHRGSFQIPVV
GITGSNGKTIVKEWLHQLLSPDRVIVRSPRSYNSQIGVPLSVWQMNEESELGIFEAGISE
MGEMRPLQNMIKPTIGILTNIGGAHQENFFSLQEKCMEKLSLFKDCDVVIYNGDNEMISN
CVGKSMLTAREIAWSMRDIERPLYISRVEKKEDHTVISYRYLEMDNTFCIPFIDDASIEN
SLNCLAACLYLMVPADQITERMARLEPVAMRLEVKDGKNNCILINDSYNSDLASLDIALD
FLYRRSQSKGLKRTLILSDILETGQSTTTLYRKVAQLVHSRGIEKIIGVGAEISSCASKF
DIEKYFFPDTKALLASDVIKKLRNEIILIKGSRNFGFDLVSEELELKVHETILEVNLGAM
VTNLNHYRSMLKPETKMVCMVKASAYGAGSYEIAKTLQEHHADYLAVAVADEGSDLRKAG
ITASIIIMDPELTAFKTMFDYKLEPEVYNFHLLDALIKAAEKEGITNFPIHVKLDTGMHR
LGFEEKDIPQLIRRLKNQNALIPRSVFSHFVGSDSAQFDAFTRQQIERYEKMSKELQDAF
PHKILRHICNTAGIERFPGAQFDMVRLGIGLYGISPIDNSIINNVSTLKTTILQIRDVTE
EDTVGYSRKGHLIRPSRIAAIPIGYADGLNRHLGCGHGYCLVNGKKAPYVGNICMDVCMI
DVTDIDCREGDQAIIFGDELPITVLSDALETIPYEVLTGISTRVKRVYYQD
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatacaattgaatcaatcgttgaaaaaataggtgcacggcgtctgggaaacaag
cctgctgccatcgactggctactgactgacagccgttcgttatgctttccggaagagacc
ctcttttttgccattcccaccaaaaggaacaacggcgcacgctacatccctgacctttat
gaacggggagtgcgcaattttgtagtcacaagcgaagatttcaaagggctcaccatggac
agtgagcaactaaaagtgacaatggctcaggaatgcaatttccttattgtccccaatact
ttaaaagcacttcagaaattggccgaacaacaccgtggttccttccagattccggtagtc
ggcattacgggcagcaatggaaagaccattgtaaaagaatggcttcaccaattgctcagc
cccgaccgggttatcgtgcgttcaccgcgcagctacaattcgcaaatcggtgtcccgctg
tcagtctggcaaatgaacgaggaatccgaactgggcattttcgaagccggcatttcggaa
atgggcgaaatgcgtccgttacagaatatgattaagccgacaataggcatcctgaccaac
attggcggagcacatcaggaaaacttcttttcactgcaagagaagtgcatggaaaaacta
agcctgtttaaagattgcgacgtagtcatttacaatggcgacaacgaaatgataagcaac
tgcgtaggaaagtcaatgctgactgcccgtgaaatcgcatggagcatgagggatatcgaa
cgtccgctctatatcagcagggttgagaagaaagaagatcataccgtcatctcctaccgc
tatctggagatggacaatacattctgtattccctttatcgatgatgcttccatagagaac
tcactgaactgcctcgctgcctgcctgtacctgatggtaccggccgaccagatcaccgaa
cgaatggcccggctcgaacctgtagcgatgcgccttgaagtaaaagacggaaagaacaac
tgtatcttgatcaatgacagttataattcggaccttgcttcgctggatatcgctctcgac
tttctttaccggcgttcgcagtcaaaaggcctaaagcgcactttgatcctttcggatatc
ctggaaaccggacaaagcacgacaacactctaccgcaaagtggcacaactggttcacagc
cgcggcattgaaaagattatcggtgtaggtgccgaaatatcctcatgcgcatcaaagttt
gatatagaaaaatatttcttccccgataccaaggcacttctggcatcagatgtaattaag
aaactcagaaatgaaatcatcctgataaaaggctcccgcaacttcggtttcgacctcgtt
tcggaagaactggaactgaaagtacacgaaaccatcctggaagtaaacctgggagctatg
gtaaccaacctgaatcactaccgctcgatgctcaaaccggaaactaaaatggtgtgcatg
gtgaaagcgtctgcttatggagcaggttcgtacgaaatagccaaaacccttcaggagcat
cacgctgactatctggcagtggccgtagccgatgaaggttccgaccttcgcaaagcaggg
atcacagcctccattatcatcatggatcccgaactgaccgctttcaaaaccatgttcgac
tataaactggaaccggaagtatacaatttccatttgctcgacgcattgataaaagccgcc
gaaaaagaaggtatcaccaacttccccattcacgtaaaactggatacgggtatgcaccga
ttgggattcgaagagaaagacatcccgcaactgattcgccggttaaagaaccagaatgca
ctgattccccgctctgtcttttcccatttcgtaggcagtgattctgcccagttcgacgct
tttacccggcagcaaatagaacgatatgaaaagatgtcaaaggaactgcaagatgcattc
ccgcacaaaatactgcgccatatctgcaacacagccggtatcgaacgcttccccggtgca
cagttcgacatggttcgtcttggcatcggattgtatggaatcagtccgatcgataactca
atcatcaacaacgtgagtaccttgaaaacaacgattctccaaatacgggacgtgacggaa
gaagatactgtaggttatagccgcaaagggcatctgatacgtccctcacgtatcgctgct
atacccatcggatatgccgacggcctgaaccgccatttgggatgcggacatggctattgc
cttgtcaatggcaaaaaagccccatacgtaggaaatatctgcatggatgtgtgcatgatc
gacgtaacggatattgattgtagagaaggtgatcaagctatcatcttcggtgacgaatta
ccgattaccgtcttatcggatgcgctcgaaaccatcccttatgaagtattgacaggtatt
tcaacccgggtcaagagagtatattatcaagattaa

DBGET integrated database retrieval system