KEGG   Bacteroides fragilis BOB25: VU15_04160Help
Entry
VU15_04160        CDS       T03897                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bfb  Bacteroides fragilis BOB25
Pathway
bfb00061  Fatty acid biosynthesis
bfb00780  Biotin metabolism
bfb01100  Metabolic pathways
bfb01130  Biosynthesis of antibiotics
bfb01212  Fatty acid metabolism
Module
bfb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bfb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VU15_04160
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    VU15_04160
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    VU15_04160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bfb01004]
    VU15_04160
Enzymes [BR:bfb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     VU15_04160
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     VU15_04160
Lipid biosynthesis proteins [BR:bfb01004]
 Fatty acid synthase
  Component type
   VU15_04160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AKA50977
UniProt: A0A081UB01
LinkDB All DBs
Position
1084579..1085436
Genome map
AA seq 285 aa AA seqDB search
MSYNLLKGKRGIIFGALNEQSIAWKVAERAVEEGAVITLSNTPVAVRMGQVSALSEKLNC
EVIAADATNVEDLENVFKRSMEVLGGQIDFVLHSIGMSPNVRKKRTYDDLDYNMLNTTLD
VSAVSFHKMIQAAKKQNAIAEYGSIVALSYVAAQRTFYGYNDMADAKALLESIARSFGYI
YGREHNVRVNTISQSPTFTTAGSGVKGMDKLYDFANRMSPLGNASADECADYCIVMFSDL
TRKVTMQNLFHDGGFSSVGMSLRAMATYEKGLDEYKDENGNIIYG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagttacaatttgttgaaaggaaaaagaggtattattttcggtgcattaaacgagcag
tctattgcctggaaagtagccgaaagagccgttgaagaaggtgctgttattacattatca
aatactcctgttgctgttcgcatgggacaggtttctgctttatcagaaaagctgaattgc
gaagtgattgctgctgatgccaccaacgtagaagatttggagaacgtattcaaacgctcg
atggaagttttgggcggacaaattgattttgtattgcactctatcggtatgtcaccgaat
gttcgtaagaaacgtacttatgatgatctcgattataatatgttgaatactacgctggat
gtttcagctgtttcgttccataaaatgattcaggctgccaagaagcaaaatgcaattgca
gaatacggttctatcgtggcattgagttatgtagctgcacagcgtactttctacggatat
aacgatatggcggatgcaaaagcattacttgaatctattgctcgcagttttggttatatc
tatggtcgtgagcacaacgtgcgtgtgaatactatttcccagtcgcctacctttacaact
gccggttctggtgtgaagggtatggataaactgtatgactttgctaatcgtatgtctccg
ctcggtaatgcttcagccgacgaatgtgctgattactgtatcgtaatgttctccgatctt
acccgtaaggtaactatgcagaacctgttccacgatggaggtttttcaagtgttggtatg
agtctgcgtgcaatggctacttacgaaaaggggctggacgaatataaagacgaaaacggt
aatatcatttacggttaa

DBGET integrated database retrieval system