KEGG   Bacteroides fragilis BOB25: VU15_05195Help
Entry
VU15_05195        CDS       T03897                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bfb  Bacteroides fragilis BOB25
Pathway
bfb00500  Starch and sucrose metabolism
bfb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VU15_05195
Enzymes [BR:bfb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     VU15_05195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AKA51159
LinkDB All DBs
Position
1338899..1341058
Genome map
AA seq 719 aa AA seqDB search
MKNMKKLTFKLACFFLSLLVSSVAMAESITSPNGLLKLNVSVNEKGEPVYELSYKGKEVI
KPSKLGLELKDDPGLMDGFTLSDAKTSSFDETWEPVWGEVKQIRNNYNELAITLDQKAQD
RKMVIRFRLYNDGLGFRYEFPQQKNLNYFVIKEEHSQFAMAGDHTAFWIPGDYDTQEYDY
TRSKLSEIRGLMKTAVTPNASQTPFSPTGVQTALQMKTDDGLYINLHEAALVDYSCMHLN
LDDKNFVFESWLTPDAQGTKGYMQTPCHSPWRTVMVSDDARDILASKLTLNLNEPCKLED
TSWIKPVKYVGVWWEMITGKSTWAYTDDVYSVKLGETDYTKTKPNGRHGANNENVKRYID
FAAEHGFGQVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFDVKMLNEYARSKGVKLMMHH
ETSASVRNYERHMDEAYQFMEDNGYNAVKSGYVGNIIPRGEHHYGQWLNNHYLYAVKKAA
DHKIMVNAHEAVRPTGLCRTYPNLIGNESARGTEYEAFGGNKPFHTTLLPFTRLIGGPMD
YTPGIFDTQLSFLSGEHSFVHTTLAKQLALYVTLYSPLQMAADLPESYERYMDAFQFIKD
VAVDWDESKYIEAEPGEYITVARKAKNTNNWFVGGITGENARTSTFVLDFLQPGKQYVAT
LYADGKDADYEKNPTSYQIKKGLVTYKTKISTDLARSGGFAISLIEATPADKKELKKWK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatgaaaaaactgacttttaagttagcttgcttttttctctctcttttagtg
agtagtgtggcaatggccgaaagtattacttctcccaacggactcttgaaactgaatgta
tctgtgaatgagaagggggaacctgtgtatgaactttcttataaaggtaaagaagtgatt
aaaccttctaaactgggtcttgaactgaaagacgatccggggttgatggacggttttacg
ttgtctgatgccaaaacttcttcttttgacgagacttgggagcctgtttggggcgaggtt
aagcaaattcgcaataattataatgaacttgcgattactttagaccagaaagctcaggat
cgcaaaatggtgattcgttttcgtctgtataatgacggactcggatttcgctacgaattt
ccacaacaaaagaatctgaattattttgtaattaaagaggaacattctcaatttgctatg
gccggtgatcatactgctttctggataccgggagattatgatacgcaggaatatgattat
actcggtcgaaactttctgaaatacgcggcttaatgaagacggctgtcactcccaatgct
tctcaaactcctttttctcctaccggtgtacagactgctttgcagatgaaaacagacgac
gggttgtatatcaatctgcacgaagctgctttggtggattattcttgcatgcatctcaat
ctggacgataagaattttgttttcgaatcgtggttgactcctgatgcccaagggaccaaa
ggatatatgcaaactccttgccactctccatggcgtacggttatggttagtgatgatgcg
cgtgatattcttgcttctaaattaacattaaatctgaacgaaccttgcaaactggaggat
acttcctggattaagcctgtaaaatacgtaggtgtatggtgggaaatgattaccggaaag
agtacttgggcttatacggatgatgtttattcagtgaagttgggcgaaaccgattatact
aaaactaagcctaatggtcgtcatggtgccaataatgagaacgtgaaacgttatattgat
tttgctgccgaacacggttttggtcaggtgctggtcgagggctggaatgaaggctgggaa
gattggttcggcaagtcaaaagactatgtgttcgacttcgttactccgtatcctgatttt
gatgtgaaaatgttgaatgagtatgctagaagtaaaggagtgaagctgatgatgcatcat
gagacttctgcatctgtgcgtaactatgaacgtcatatggatgaagcttatcaatttatg
gaagataacggttacaatgcggtgaagagtggatatgttggcaatatcatcccacgtggt
gaacaccactacggtcaatggctgaataatcattatctgtatgcggtgaagaaagctgcg
gatcataaaattatggtgaatgcacacgaggctgttcgccctactggattgtgccgtaca
tatccgaatctgattggtaatgaatctgcccgtggtacagaatatgaagccttcggaggc
aataagcctttccatactacgttgcttccatttacgcgtctgataggtggtccgatggat
tatactccgggtattttcgatactcaactctctttcctgagtggtgagcatagttttgta
catactactttggccaaacagttggctttgtatgtcactctttatagcccattacagatg
gctgccgatcttccggagagttatgaacgctatatggatgcctttcagtttattaaagat
gtagcagtagactgggatgaaagtaagtatattgaagcagaaccgggagagtacatcact
gtggcccgtaaagctaaaaacaccaataattggttcgttggaggaattactggtgaaaat
gcacgtacatctacgtttgtacttgatttcctgcaaccgggaaagcaatatgtagctact
ttatatgccgatggtaaagatgcggattatgaaaagaatccgacttcttatcagattaaa
aaaggtctggtgacttataagacgaagatttccactgatttggcccgtagtggaggtttt
gctattagtttgatagaggctacccctgccgataagaaagaacttaaaaagtggaaataa

DBGET integrated database retrieval system