KEGG   Bacteroides fragilis BOB25: VU15_05435Help
Entry
VU15_05435        CDS       T03897                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bfb  Bacteroides fragilis BOB25
Brite
KEGG Orthology (KO) [BR:bfb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VU15_05435
Enzymes [BR:bfb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VU15_05435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_binding_2 GIDA FAD_oxidored Thioredoxin_3 DAO Thi4 NAD_binding_8 NAD_binding_7 Thioredoxin_4 AlaDh_PNT_C Lycopene_cycl Glutaredoxin DSBA FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AKA51203
UniProt: Q9RQ71
LinkDB All DBs
Position
complement(1395868..1397418)
Genome map
AA seq 516 aa AA seqDB search
MLDSAIKEQLRTIFAALEANYTFDITVSPQHESRTELLELLNDVASCSEKLSCRINEGKG
LEFTLLKGEHRTGITFRAVPNGHEFSSLLLAILNTDGKGKNFPDEGICNRVKSLKGPVRL
TTYVSLTCTNCPDVVQALNAMTTLNGQIQHQTVDGAINQAEVEALKIQGVPSVFADGKLI
HVGRGDFGELLAKLEEQYGTETNSAETSIKKYDVIVAGGGPAGSAAAIYSARKGLNVAVI
AERIGGQVKETVGIENLISVPSTTGSQLADNLKTHMSQYPIDLLEHRQIEKIELDGKDKV
LTAKGGERFSAPAVIVATGASWRKLNVPGEAEYIGRGVAFCPHCDGPFYKGKQVAVVGGG
NSGIEAAIDLAGICSKVTVLEFMDELKADQVLQEKLKSLPNVEVLVHSQTTEVVGNGDKV
TGIRVKDRKTEEERVISLDGIFVQIGLVANSGIFRDVVEVNRPGEIVIDAHCRTNVPGIY
AAGDVSTVPYKQIIIAMGEGAKAALAAFEDRMRGEI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagactcagctataaaagaacaattacgtaccatcttcgctgcattggaggcgaac
tatacattcgacatcaccgtctcaccgcaacacgaaagccgcaccgaacttctggaactc
ctgaacgatgtggcatcctgctccgagaaactctcttgccggatcaatgaaggcaaagga
ctggaatttacacttctcaaaggagaacacaggacaggtatcaccttccgggccgttccc
aatgggcatgaattcagttccctactgcttgccatcctgaatacggacggaaaaggaaag
aactttccggacgaaggcatatgcaaccgggtaaaatcattgaaaggacctgtccgcctg
acaacttacgtgtcactgacctgtaccaactgccccgacgtggtgcaggcactcaacgcc
atgaccacgctgaacggacagattcagcaccagactgtggacggagccatcaaccaggcg
gaagtagaggcactgaaaatacagggggttccttctgtcttcgcagacggtaaactgatc
cacgtggggcgtggtgactttggcgaactgttggccaaactggaagaacaatatggaacg
gagacgaacagtgcggaaacttccatcaaaaaatatgatgtgattgtagccggcggaggt
ccggccggttcggctgctgccatctattcggcccgtaaaggcttgaatgtagcggtcatt
gccgaacggatcggcggacaagtaaaagaaacagtaggcatagagaacctgatctccgta
ccttcgacaaccggaagccagttggccgataatctgaaaacccacatgtcacaatatccc
atcgatttgctcgaacatcgccagatcgaaaagatagagcttgatggaaaggataaggtt
ctgacagccaaaggaggagaacgtttctcagctccggcggtaatcgttgccaccggtgca
agctggcgcaaactgaacgtaccgggcgaagcggaatatatcggccgtggggtggctttc
tgtccacactgcgacggacctttctacaaagggaagcaggtggctgtcgtggggggagga
aattccggaatcgaagcagccatcgacctggcaggtatctgctccaaagttacggtgctc
gagtttatggacgagctgaaagcggatcaggttttacaggaaaaactgaaaagcctgccg
aatgtagaagttcttgttcactcgcagacaaccgaagtggtaggcaatggagataaggtg
accggcatccgtgtcaaagaccgcaaaacagaagaagaacgggtgatcagcctggatggc
atctttgtacagataggtttggtagccaatagtggtattttccgcgatgtggttgaggta
aatcgtccgggcgagatcgtgatcgatgcacattgccgtaccaacgtgccgggaatttat
gctgccggagacgtttccaccgtcccctacaaacagattatcatcgcaatgggagaaggc
gccaaagccgcattagccgcattcgaggatcggatgcgaggagaaatttaa

DBGET integrated database retrieval system